Zapstore
_@zapstore.devDownload 1.1.2 for Android: https://zapstore.dev/ SHA-256 checksum: 29b7aae256ef567e466c30fac13b8a7794d84a79862162d69f029f61c2ce5dd2 APK certificate hash (for AppVerifier): 99e33b0c2d07e75fcd9df7e40e886646ff667e3aa6648e1a1160b036cf2b9320 Nostr DMs will be ignored, tag us instead.
78ce6faa72264387284e647ba6938995735ec8c7d5c5a65737e55130f026307d
The Zapstore main account — this pubkey republishes apps from GitHub / F-Droid.
4,848 apps published.
257 Zapstore-attributed zaps in the past year.
661,838 sats received in the past year.
Apps (4,848)
Zapstore dev.zapstore.appFirst release: Jun 9, 2025
Tabs Lite com.gbros.tabslitePlay your favorite song in any key with millions to choose from!
First release: Jan 25, 2026
- Zapstore Alpha dev.zapstore.alpha
First release: Dec 26, 2025
- Voyage com.dluvian.voyage
First release: May 26, 2025
Vela Maps app.velaFirst release: Oct 8, 2026
DAVx⁵ at.bitfire.davdroidFirst release: Sep 13, 2025
PipePipe InfinityLoop1309.NewPipeEnhancedA FLOSS Android app to let you browse YouTube, NicoNico and BiliBili freely.
First release: Aug 23, 2025
Nunchuk io.nunchuk.androidFirst release: Sep 4, 2025
- LibreTube com.github.libretube
First release: May 7, 2025
BULL com.bullbitcoin.mobileFirst release: Aug 6, 2025
Mullvad VPN net.mullvad.mullvadvpnFirst release: Sep 22, 2025
Electrum org.electrum.electrumFast and self-custodial wallet for Bitcoin and the Lightning Network
First release: Jan 5, 2026
bitchat com.bitchat.droidFirst release: Sep 15, 2025
Tuta de.tutao.tutanotaEncrypted email & calendar service - easy to use, secure by design.
First release: Sep 19, 2025
DuckDuckGo com.duckduckgo.mobile.androidPrivacy, simplified
First release: Sep 17, 2025
AntennaPod de.danoeh.antennapodEasy-to-use, flexible and open-source podcast manager and player
First release: Dec 1, 2025
Aegis com.beemdevelopment.aegisFirst release: Aug 3, 2025
Brave com.brave.browserFirst release: Sep 18, 2025
Bitwarden com.x8bit.bitwardenFirst release: Sep 18, 2025
NewPipe org.schabi.newpipeA free lightweight YouTube frontend for Android.
First release: Jul 31, 2025
- BLE Radar f.cking.software
First release: Jan 10, 2026
Breezy Weather org.breezyweatherA feature-rich weather app with good visualizations and many sources.
First release: Jun 22, 2025
Calorimeter de.swgross.calorimeterFirst release: Sep 3, 2026
CoMaps app.comapsFirst release: Jan 19, 2026
FairEmail eu.faircode.emailFirst release: Sep 22, 2025
F-Droid org.fdroid.fdroidThe app store that respects freedom and privacy
First release: May 22, 2025
Fedi com.fediFirst release: Oct 6, 2025
FeedMe com.seazon.feedmeFirst release: Sep 12, 2025
Finamp com.unicornsonlsd.finampFirst release: Jan 25, 2025
Image Toolbox ru.tech.imageresizershrinkerEdit, create & convert images with powerful AI — your all-in-one studio
First release: Jul 15, 2025
- Kriptofolio com.baruckis.kriptofolio
First release: Aug 21, 2026
- Kuaizi IME org.crazydan.studio.app.ime.kuaizi
First release: May 31, 2025
NouTube jp.nonbili.noutubeYouTube and YouTube Music in a single app. No ads, plays in the background.
First release: Sep 10, 2025
Odysee com.odysee.appFirst release: Dec 26, 2025
Open Note com.yangdai.opennoteFirst release: Sep 17, 2025
Podverse com.podverse.fdroidPodcast app with clips, video, livestreams, playlists, profiles, and cross-platform syncing.
First release: May 14, 2024
Proton Mail ch.protonmail.androidFirst release: Sep 2, 2025
Puzzle com.sidhant.puzzle300+ minimalist brain games. Challenge your logic, memory & attention in game
First release: Aug 10, 2026
Smoking Tracker com.gasperpintar.smokingtrackerTrack your smoking and see daily, weekly, monthly and yearly statistics
First release: Aug 26, 2026
Trezor Suite io.trezor.suiteFirst release: Jan 29, 2026
Vault Explorer com.aeidolon.vaultexplorerEncrypted container explorer: VeraCrypt, LUKS, BitLocker, Cryptomator, gocryptfs
First release: Aug 16, 2026
Cake Wallet com.cakewallet.cake_walletFirst release: Sep 9, 2025
- MJ PDF com.gitlab.mudlej.MjPdfReader
First release: May 19, 2024
Yagni Launcher com.eblan.launcherStock Android Launcher From Scratch
First release: Feb 6, 2026
aRDP Free com.iiordanov.freeaRDPFirst release: Feb 9, 2026
Ente Photos io.ente.photos.independentFirst release: Sep 6, 2025
Obscura VPN net.obscura.vpnclientappFirst release: Jun 5, 2026
Shattered Pixel Dungeon com.shatteredpixel.shatteredpixeldungeonFirst release: Sep 15, 2025
Immich app.alextran.immichFirst release: Sep 22, 2025
Orbot org.torproject.androidFirst release: Jul 16, 2024
BlueWallet io.bluewallet.bluewalletRadically simple, powerful & secure Bitcoin wallet. Lightning & open source.
First release: May 13, 2025
Blockstream App (Green) com.greenaddress.greenbits_android_walletFirst release: Sep 8, 2025
FossWallet nz.eloque.foss_walletFirst release: Sep 23, 2025
ntfy io.heckel.ntfyFirst release: Dec 11, 2022
Padawan Wallet com.coyotebitcoin.padawanwalletFirst release: May 26, 2025
Kai 9000 com.inspiredandroid.kaiOpenClaw alternative in your pocket
First release: Feb 11, 2026
Compressor compress.joshattic.usLightning fast, ad free, super lightweight native video compressor
First release: Feb 3, 2026
Molly im.molly.appFirst release: Aug 26, 2025
GeoShare page.ooooo.geoshareOpen map links in other map apps and copy coordinates
First release: Sep 19, 2025
- Keepass2Android keepass2android.keepass2android
First release: Sep 20, 2025
Mental Math com.helddertierwelt.mentalmathPractice mental arithmetic solo or compete with friends.
First release: Jan 3, 2026
Radar com.radarlabs.radarFirst release: Jul 7, 2026
Baba com.ravenfeld.panoramax.babaFirst release: Sep 8, 2025
WireGuard com.wireguard.androidFirst release: Dec 23, 2025
Binary Eye de.markusfisch.android.binaryeyeFirst release: Aug 26, 2025
White Noise org.parres.whitenoiseFirst release: Oct 8, 2026
CAPod eu.darken.capodCAPod is a companion app for AirPods on Android.
First release: Feb 9, 2026
Phoenix fr.acinq.phoenix.mainnetFirst release: Sep 18, 2025
- Tor Browser org.torproject.torbrowser
First release: Sep 26, 2025
- GPSTest com.android.gpstest.osmdroid
First release: Dec 28, 2024
LocalSend org.localsend.localsend_appCross-Platform file sharing solution via WiFi.
First release: Feb 20, 2025
Reef dev.pranav.reefBoost focus by pausing apps, setting limits, and managing distractions.
First release: Sep 19, 2025
- BuhoGo mybuho.buhogo
First release: Jan 20, 2026
KeePassDX com.kunzisoft.keepass.freeFirst release: Sep 12, 2025
KeePassDX com.kunzisoft.keepass.libreManage Passkey / Password in a local and open-source vault
First release: Jan 16, 2026
Zaplite dev.zapstore.liteLightweight Zapstore client. 1.5 MB. Updates and installs by app ID.
First release: Oct 10, 2026
Librera FD com.foobnix.pro.pdf.readerBook and PDF reader
First release: Jul 10, 2025
Tasks org.tasksPrivate, ad-free task lists! Optional sync with Google Tasks, CalDAV or EteSync!
First release: Sep 26, 2025
Gopeed com.gopeed.gopeedFirst release: Sep 14, 2025
OneMoreSecret com.onemoresecretYour phone as a key to your secrets - no master password, no cloud.
First release: Nov 4, 2025
Celestia space.celestia.mobilecelestiaFirst release: Sep 24, 2025
Photok dev.leonlatsch.photokFirst release: Sep 25, 2025
- 자커마스 cc.occm.app
First release: Jul 31, 2026
- 0x54ask com.terokarvinen.x54ask
First release: Sep 3, 2026
- 0x56erify dev.x56.verify
Local, offline SHA-256/SHA-512 checksum verification.
First release: Oct 1, 2026
- 11 Cell Network Changer com.tre.a11cellnetworkchanger
First release: Jun 3, 2025
1Key com.roufsyed.onekeyOffline password manager. 2FA + notes. No account, no network, no telemetry.
First release: Oct 12, 2026
- 1List com.lolo.io.onelist
First release: Oct 6, 2024
- 2048 org.secuso.privacyfriendly2048
First release: Jul 21, 2025
2048 Open Fun Game org.andstatus.game2048First release: Jan 6, 2025
2fa app.ninesevennine.twofactorauthenticatorFirst release: Sep 25, 2026
2FAS Auth com.twofasappFirst release: Aug 26, 2025
- 32steps com.thirtytwo.steps
First release: Aug 14, 2026
- 37C3 Wifi Setup nl.eventinfra.wifisetup
First release: Oct 17, 2024
39C3 Schedule info.metadude.android.congress.scheduleFirst release: Jul 31, 2026
3D Geometry Animation io.github.nvlad1.function3danimatorBuild and animate 3D mathematical surfaces offline
First release: Oct 8, 2026
- 3D Model Viewer org.andresoviedo.dddmodel2
First release: Apr 23, 2017
3X-UI Manager net.yukh.xuiManage your 3x-ui / Xray proxy panels from your phone
First release: Aug 3, 2026
500 io.github.rotundtapir.fivehundredPlay 500, the Australian trick-taking card game — bots or friends online.
First release: Aug 26, 2026
508.dev Soundboard dev.co508.soundboardMix looping ambient sounds, each at its own volume. Offline, free, no ads.
First release: Sep 14, 2026
531 Log com.willamesjr.fivetlogTrack your workouts and progress with the 5/3/1 method.
First release: Sep 20, 2025
5G com.openappslabs.fivegA simple utility to force "NR Only" 5G network mode.
First release: Jan 3, 2026
5G Proxy Client com.tokyoxpa3.socksclientRoutes device traffic through a remote SOCKS5 proxy via TUN. No root, TCP/UDP.
First release: Oct 10, 2026
5G Proxy Pro com.tokyoxpa3.androidproxyShare your phone's 5G/4G over Wi-Fi via SOCKS5 proxy. No root, TCP/UDP, LAN-only.
First release: Aug 26, 2026
8-Bit Wonders de.rainerhock.eightbitwondersFlexible and easy to use Commodore 8-bit emulation with builtin games
First release: Dec 31, 2025
- 8Vim inc.flide.vi8
First release: Jun 28, 2024
- 8Vim RC inc.flide.vi8.rc
First release: Oct 29, 2024
99Managers Futsal Edition org99managers.futsal_editionA futsal management game with a 2D match engine and integrated editor.
First release: Jul 29, 2026
AAAAXY io.github.divverent.aaaaxyFirst release: Sep 1, 2025
AA-AuralListen Podcatcher io.github.rainerwingel.aurallistenPrivate, ad-free podcast app – audio only, no account, all data on your phone
First release: Oct 15, 2026
- Aalener Optik-Formelrechner de.HS_Aalen.don
First release: Aug 9, 2024
Aard 2 itkach.aard2Offline dictionary
First release: Jul 16, 2024
- AAT ch.bailu.aat
First release: Oct 23, 2025
Abstract Dots and Lines com.towerillusion.abdalAbstract Dots and Lines is a libre implementation of a pen-and-paper game.
First release: Sep 14, 2026
- Accelerrace org.asafonov.accelerace
First release: Aug 12, 2025
Accessibility Button Launcher com.pedronveloso.a11ybuttonAssign one app or app shortcut to the Android accessibility button
First release: Oct 12, 2026
AccessSupporter com.masterisk_f.accesssupporterFirst release: Feb 8, 2026
Accordion org.billthefarmer.accordionAccordion emulator
First release: Aug 19, 2022
Accrescent app.accrescent.clientFirst release: Aug 27, 2025
- Acho com.acho.chat.app
First release: Jul 31, 2026
Acode com.foxdebug.acodeCode editor for Android with Linux terminal, Git, plugins and AI tools.
First release: Aug 29, 2025
- Acoustic com.metalshard.projectwave
First release: Jul 31, 2026
- activeTAN de.varengold.activeTAN
First release: Sep 6, 2024
- Activity Launcher de.szalkowski.activitylauncher
First release: Jul 31, 2026
Activity Launcher de.szalkowski.activitylauncher.ossFirst release: Jun 15, 2025
Activity Manager com.activitymanagerAdvanced activities and shortcuts launcher
First release: Feb 9, 2026
Activity Trace com.activitytraceFind something you saw on your phone — privately and on-device.
First release: Aug 12, 2026
ActivityWatch net.activitywatch.androidTrack how you spend your time on your devices.
First release: Oct 13, 2023
Acutis Firewall com.acutis.firewallParental control app that blocks adult content and dangerous sites on-device.
First release: Sep 3, 2026
- Adapt It Mobile org.adaptit.adaptitmobile
First release: Jan 10, 2026
Adaptive Theme dev.lexip.hecateFirst release: Sep 2, 2026
AdaptKey de.froehlichmedia.adaptkeyPrivacy-first Android keyboard that learns your typing style. Fully offline.
First release: Sep 27, 2026
AdAway org.adawayFirst release: Oct 27, 2024
ADB Captain adb.captainRun ADB commands on your phone. No root, no PC — via Shizuku.
First release: Sep 20, 2026
- ADB Clipboard ch.pete.adbclipboard
First release: Oct 4, 2025
AddictoLogs com.addictologsFirst release: Jan 20, 2025
addy.io host.stjin.anonaddyAnonymous Email Forwarding
First release: Jul 25, 2025
- ad-free ch.abertschi.adfree
First release: Aug 30, 2026
AdGuard com.adguard.androidFirst release: Jun 25, 2025
- AdGuard Content Blocker com.adguard.android.contentblocker
First release: Oct 21, 2024
Adiresy org.github.nynosy.adiresy_mobileFind, share and navigate to Madagascar's community address codes
First release: Aug 23, 2026
- ADLMIDI Player ru.wohlsoft.adlmidiplayer
First release: Sep 21, 2025
ADNS com.eyalm.adnsFirst release: Aug 2, 2026
Adresilo com.adresilo.androidFirst release: May 18, 2025
- Ad-silence bluepie.ad_silence
First release: Jan 10, 2026
Advanced PassGen com.codedead.advancedpassgenFirst release: Mar 19, 2025
Advanced PortChecker com.codedead.advancedportcheckerCheck if TCP ports are open.
First release: Mar 11, 2025
AELF co.epitre.aelf_lecturesA simple and discrete daily reading application (french only)
First release: Oct 23, 2025
Aenigma ro.aenigmaCommunicate unconstrained of commercial imperative. No data collection.
First release: Aug 27, 2025
- Aer alt.nainapps.aer
First release: Jan 19, 2026
Aerial com.shapeshed.aerialJust radio.
First release: Jul 31, 2026
Aerith com.aerithFirst release: Feb 14, 2026
aFreeRDP com.freerdp.afreerdpFirst release: Jan 3, 2026
Africa Quiz com.mufradat.africaquizQuiz game testing your knowledge of African capital cities
First release: Oct 8, 2026
- Afrikaans for AnySoftKeyboard com.anysoftkeyboard.languagepack.afrikaans_oss
First release: Jul 31, 2026
Aftergleam si.jakobkreft.aftergleamA private reader for new research papers, ranked on your phone.
First release: Oct 2, 2026
AFWall+ dev.ukanth.ufirewallControl network traffic
First release: Dec 23, 2025
- AF Weather net.gitsaibot.af
First release: Mar 16, 2026
- AF Weather net.gitsaibot.af.debug
First release: Aug 3, 2026
Agenda Tech com.filestech.agenda_techPrivate offline calendar: encrypted, zero network, encrypted backups.
First release: Oct 3, 2026
Agent com.mobilefork.hermesagentLocal AI chat, your models, and practical Android tools
First release: Aug 14, 2026
AgePony com.agepony.appPost-quantum file & message encryption with age. On-device, private, no ads.
First release: Aug 12, 2026
- Aggregator com.tughi.aggregator
First release: Jun 19, 2024
Agora com.newoether.agoraBYOK LLM client with multi-provider access, agentic workflows, remote control
First release: Aug 6, 2026
- AG Store org.strawberryforum.argentum
First release: Sep 14, 2024
- AI Hub com.foss.aihub
First release: Feb 22, 2026
AIPOS Password Manager com.aipos.aipospmPremium, fully offline, and secure Android password and 2FA TOTP manager.
First release: Aug 27, 2026
AirGuard de.seemoo.at_tracking_detectionFirst release: Oct 8, 2026
AirGuard de.seemoo.at_tracking_detection.releaseAirGuard detects trackers that are used for stalking and warns you.
First release: Sep 9, 2025
AirheadWaves space.ring0.airheadwavesStream Android audio to any Linux device over WiFi
First release: Oct 25, 2025
AirLyrics com.andsi.airlyricsSynced floating lyrics: online search, local imports, and word-by-word support
First release: Aug 11, 2026
Airplane Scheduler io.github.probecat.airplaneschedulerAutomatically switch airplane mode on and off on a schedule
First release: Oct 16, 2026
airplanes.live eu.darken.aplFirst release: Aug 14, 2025
AirPlay Server io.github.jqssun.airplayAirPlay receiver implementation for Android with video and audio support.
First release: Aug 3, 2026
AIS-catcher com.jvdegithub.aiscatcherFirst release: Nov 23, 2025
Aisleron com.aisleronFirst release: Sep 20, 2025
Aiyo com.beradeep.aiyoFirst release: Nov 11, 2025
aka Alarm com.aka.alarmFirst release: Aug 8, 2026
- Aktivpause to Go org.secuso.aktivpause
First release: Aug 22, 2025
Alarmetrics co.adityarajput.alarmetricsTrack your snoozes
First release: Feb 9, 2026
- Alarm Klock com.angrydoughnuts.android.alarmclock
First release: Jun 25, 2025
- Al-Azan com.github.meypod.al_azan
First release: Aug 17, 2024
Albi ai.privatebydesign.albiA health tracking app that respects your privacy
First release: Aug 21, 2026
AL-chan com.zen.alchanFirst release: Aug 25, 2024
Alchemist com.vayunmathur.games.alchemistFirst release: Jul 29, 2026
Alembicons com.kaanelloed.iconerationIcon pack creator and Arcticons companion
First release: Feb 7, 2025
- Alertly com.example.notificationalerter
First release: Jan 21, 2026
AlexCalc net.alexbarry.calc_androidFirst release: Jun 19, 2025
AlexGames net.alexbarry.alexgamesFirst release: May 9, 2024
Alex vs Bus: The Race com.github.m374lx.alexvsbusFirst release: Jun 17, 2025
- AlgoSorts io.github.dmitrytsyvtsyn.algosortinganimations
First release: May 6, 2024
AliasVault net.aliasvault.appFirst release: Sep 19, 2025
- Alibi app.myzel394.alibi
First release: Jan 19, 2026
Aliucord Installer com.aliucord.installerFirst release: Aug 16, 2024
- Alkaa com.escodro.alkaa
First release: Jul 18, 2025
- Alkitab yuku.alkitab
First release: Apr 24, 2024
Alligator Bytes org.residuum.alligatorRecord musical loops, play them back, and change the sound with movement.
First release: Dec 2, 2025
Alovoa com.alovoa.expoOpen-source online dating application
First release: Feb 2, 2026
AlphaGPS com.saschl.cameragpsTransmit your phone's location to Sony cameras over Bluetooth for geotagging
First release: Oct 9, 2026
Alpi Maps akylas.alpi.mapsowerful outdoor maps & navigation — everything works 100% offline or online
First release: Jan 19, 2026
Al-Quran com.github.meypod.al_quranA simple open-source Quran reader
First release: Nov 27, 2025
- Alternate com.lulu786.Alternate
First release: Aug 4, 2025
- AlternativeUnlockXposed com.leohearts.alternativeUnlockHook
First release: Mar 9, 2025
AltLocationServices com.opengps.altlocationservicesConnects to BeaconDB geolocation service to provide network location services.
First release: Apr 4, 2025
- AlwaysOn io.github.domi04151309.alwayson
First release: May 14, 2025
- Always on display toggle org.alberto97.aodtoggle
First release: Jul 13, 2024
Amadz com.talsk.amadzClean & intuitive Phone Dialer app following Material Design principles.
First release: Jul 16, 2025
AMARadio com.ounben.amaradioAd-Free - No Paywall - Just Radio
First release: Sep 23, 2026
- Amarok deltazero.amarok.foss
First release: Nov 26, 2025
Amaze com.amaze.filemanagerFirst release: Feb 17, 2024
- Amaze Utilities com.amaze.fileutilities
First release: Jul 17, 2024
Ambio com.jbgsoft.ambioBlend up to 3 of 12 ambient sounds into a focus soundscape you build yourself
First release: Sep 19, 2026
- Ameixa org.xphnx.ameixa
First release: Mar 24, 2024
AmneziaVPN org.amnezia.vpnFirst release: Aug 27, 2025
Ampersand moe.ampersand.appFirst release: Oct 8, 2026
- Ampersand moe.ampersand.track.sideload
First release: Oct 8, 2026
- Am Sprung at.h4x.amsprung
First release: Aug 1, 2026
- Analog Clock Widget eu.nemui.ailin.uclock
First release: Apr 9, 2024
Anarch RE dev.serwin.AnarchREFirst release: Oct 16, 2025
Anchor Chain com.anchor.chainSafe anchoring with physics
First release: Sep 26, 2026
AndIodine org.xapek.andiodineFirst release: Jul 21, 2025
- AndME Launcher com.dustinhendriks.andme
First release: May 17, 2024
- Andor's Trail com.gpl.rpg.AndorsTrail
First release: Nov 1, 2025
- AnDraw se.constructions.andraw
First release: Aug 3, 2026
- AndrOBD com.fr3ts0n.ecu.gui.androbd
First release: Jul 28, 2025
- Android 2 Linux Notifications dev.patri9ck.a2ln
First release: Jun 15, 2025
- Android Auto - XLauncher Unlocked com.google.android.projection.gearhead.xunlocked
First release: Apr 10, 2023
androidcrypt com.androidcryptFirst release: Aug 10, 2026
- AndroidCrypt com.dewdrop623.androidcrypt
First release: Aug 25, 2025
Android IP Camera com.github.digitallyrefined.androidipcameraAn Android H.264 / MJPEG IP Camera app
First release: Jul 29, 2026
- Android LUKS eu.fulldisclosure.android.luks
First release: Jun 9, 2024
AndroidMic io.github.teamclouday.AndroidMicUse your Android phone as a microphone for your PC
First release: Sep 15, 2025
- AndroidSDK easter egg showcase com.trianguloy.isUserAMonkey
First release: Jul 15, 2025
- Android System WebView com.thorium.webview
First release: Jul 31, 2026
- Android USB Script org.netdex.androidusbscript
First release: Jul 20, 2024
- Android Virtual Pen com.virtual_pen
First release: Apr 14, 2024
- Androoster com.andreacioccarelli.androoster
First release: Mar 17, 2025
Andropolis io.github.ds17f.andropolisClassic city building: an open-source Android port of Micropolis (SimCity).
First release: Oct 3, 2026
- AndStatus org.andstatus.app
First release: Dec 14, 2024
- ANeko org.nqmgaming.aneko
First release: Jan 23, 2026
- Anemo exe.bbllw8.anemo
First release: Feb 15, 2025
AniHyou com.axiel7.anihyouAnother unofficial Android AniList client
First release: Jun 22, 2025
Animetail com.dark.animetailv2Full-featured player and reader, based on Mihon.
First release: Oct 7, 2026
AnInspector razertexz.aninspectorA minimalist Android package inspector.
First release: Sep 28, 2026
AniSync com.anisync.androidOffline-first AniList client for anime and manga tracking with widgets
First release: Sep 20, 2026
- Aniyomi xyz.jmir.tachiyomi.mi
First release: Jul 6, 2025
- Ankiconnect Android com.kamwithk.ankiconnectandroid
First release: Jun 22, 2025
AnkiDroid com.ichi2.ankiMemorize anything with AnkiDroid!
First release: Aug 2, 2025
- AnLinux exa.lnx.a
First release: Jan 22, 2026
Anonomi Messenger org.anonomi.androidDecentralized messaging for high-threat environments
First release: Aug 11, 2026
Anonomi Postbox org.anonomi.postboxSelf-hosted relay that holds Anonomi messages until you are back online
First release: Oct 4, 2026
another.im im.narayana.anotherFirst release: Oct 3, 2026
- Another Notes com.maltaisn.notes.sync
First release: Dec 1, 2025
ANOTHERpass de.jepfa.yapmFirst release: Aug 28, 2025
- Another Term green_green_avk.anotherterm.oldgood
First release: May 27, 2024
ANPASIDE com.github.helltar.anpasideFirst release: Oct 21, 2025
- Anthology systems.nik.anthology
First release: Dec 28, 2025
- AntiBrightnessChange com.programminghoch10.AntiBrightnessChange
First release: Jul 31, 2026
AntiiQ com.coleblvck.antiiqA Music Player for Music Collectors and Enthusiasts.
First release: Oct 27, 2025
Anti-Vocale com.antivocale.appTranscribe voice notes and calls on-device
First release: Aug 4, 2026
Anti-Vocale (Debug) com.antivocale.app.debugTranscribe voice notes and calls on-device
First release: Oct 7, 2026
- AntiWakeLock com.programminghoch10.AntiWakeLock
First release: Jan 23, 2026
- Anuto TD ch.logixisland.anuto
First release: Oct 1, 2024
- Anx Reader com.anxcye.anx_reader
First release: Sep 14, 2025
- AnyMemo org.liberty.android.fantastischmemo
First release: Jul 31, 2026
AnymeX com.ryan.anymexFirst release: Sep 1, 2025
AnySoftKeyboard com.menny.android.anysoftkeyboardFirst release: Jan 5, 2022
- AnySoftKeyboard 3D Theme com.anysoftkeyboard.theme.three_d
First release: Jul 31, 2026
- AnySoftKeyboard - Hebrew Language Pack com.anysoftkeyboard.languagepack.hebrew
First release: Jul 31, 2026
Anytime Player uk.me.amugofjava.anytimeFirst release: Jan 21, 2026
AnyWebView com.thinkdifferent.anywebviewFirst release: Dec 15, 2024
Anywherelan com.anywherelan.awlPeer-to-peer mesh VPN to connect your devices directly, no central servers
First release: Oct 24, 2026
APatch me.bmax.apatchFirst release: Jul 7, 2025
- API Flow io.github.jeffin_v.apiflow
First release: Sep 20, 2026
- APK Explorer & Editor com.apk.editor
First release: Sep 30, 2025
APK Extractor com.vadhod.apkextractorOffline, privacy-first APK extractor with proper split-APK support.
First release: Aug 27, 2026
- APK Extractor io.github.abdurazaaqmohammed.ApkExtractor
First release: Oct 24, 2024
APKUpdater com.apkupdater.ciGet updates from multiple sources
First release: Feb 8, 2025
- APlayer remix.myplayer
First release: Feb 8, 2026
- Aplin com.nagopy.android.aplin
First release: Dec 1, 2024
APM com.noxplay.noxplayerFirst release: Sep 17, 2025
APODroid io.github.buerlino.apodroidSets NASA's pictures of the day as your wallpaper, on its own
First release: Oct 16, 2026
- Apollo org.nuclearfog.apollo
First release: Jan 25, 2026
- App2Proxy dev.rx.app2proxy
First release: May 30, 2025
- AppInfoFix io.github.juby210.appinfofix
First release: Aug 19, 2024
Apple Flinger com.gitlab.ardash.appleflinger.androidFirst release: Mar 23, 2025
AppListBackup org.androidlabs.applistbackupFirst release: Apr 14, 2025
- App Lock dev.pranav.applock
First release: Aug 5, 2025
App Manager io.github.muntashirakon.AppManagerA fully-featured package manager for android.
First release: Jul 28, 2025
- App Settings Reborn ru.bluecat.android.xposed.mods.appsettings
First release: May 14, 2023
AppStow de.pritcloud.appstowOrganize and launch apps, websites, web apps and deep links
First release: Oct 14, 2026
- Appstract dev.appstract.iconpack
First release: Jul 31, 2026
- Appteka com.tomclaw.appsend
First release: Feb 5, 2026
- AppVaultX in.sunilpaulmathew.appvaultx
First release: Oct 19, 2025
AppVerifier dev.soupslurpr.appverifierFirst release: Jan 17, 2025
AppVerifier BG com.roundsalmon4.appverifierVerify installed apps against shared signature hashes and databases.
First release: Aug 19, 2026
AppVolMgr moe.chensi.volumeFirst release: Aug 17, 2025
AQUA io.aquawallet.androidFirst release: Aug 25, 2025
AquarellNotes com.solar.aquarellnotesCalm local notes and shopping lists with watercolor-inspired design
First release: Sep 3, 2026
- Arabic for AnySoftKeyboard com.anysoftkeyboard.languagepack.arabic
First release: Jul 31, 2026
Arcade com.arthur.arcadeA minimal game launcher with a twist
First release: Aug 4, 2026
Arcanum zip.arcanumEncrypted container manager compatible with VeraCrypt
First release: Aug 7, 2026
Archiv com.armanmaurya.archivFirst release: Oct 7, 2026
ArchiveKeep org.archivekeep.ArchiveKeepArchive files the easy way
First release: Jun 17, 2025
- ArchiveTune moe.koiverse.archivetune
First release: Jan 21, 2026
ArchiveTune moe.rukamori.archivetuneThe cutest Modern music player with local and YouTube support.
First release: Jun 24, 2026
- Arcticons com.donnnno.arcticons
First release: Aug 28, 2025
- Arcticons Black com.donnnno.arcticons.light
First release: Aug 28, 2025
- Arcticons Day & Night com.donnnno.arcticons.daynight
First release: Jul 31, 2026
- Arcticons Material You com.donnnno.arcticons.you
First release: Jul 31, 2026
Areada app.areadaFirst release: Sep 3, 2026
Argus dev.argusNatural-language automation compiled by an LLM, run by a deterministic engine.
First release: Aug 21, 2026
Aria com.poppingmoon.ariaDive into the interplanetary microblogging platform 🚀
First release: Feb 3, 2026
Aria2Android com.gianlu.aria2androidFirst release: Oct 12, 2023
Aria2App com.gianlu.aria2appFirst release: Sep 14, 2024
- a-rithist com.github.sourzo.a_rithist
First release: Aug 2, 2025
- Arity org.woheller69.arity
Scientific calculator for Android 5+
First release: Sep 29, 2025
ARK-launcher org.arkikeskus.launcherA modern, customizable home-screen launcher built with Jetpack Compose
First release: Oct 12, 2026
- Armada pub.armada.app
First release: Jul 31, 2026
- Armenian for AnySoftKeyboard com.anysoftkeyboard.languagepack.armenian2
First release: Jul 31, 2026
Arrow Escape com.sidhant.arrowescapeMinimalist arrow puzzle game with infinite levels, zero ads, and total privacy
First release: Aug 3, 2026
- Arru com.kssidll.arru
First release: Sep 14, 2025
- ArtNet Receiver de.nkoeppel.artnet_receiver
First release: Mar 1, 2025
- Artvee for Muzei com.example.muzei.muzeiartvee
First release: Aug 13, 2025
Arx Libertatis com.arxlibertatisFirst release: Feb 3, 2025
aShell in.sunilpaulmathew.ashellaShell: A local ADB shell for Shizuku powered android devices
First release: Jan 5, 2026
aShell You in.hridayan.ashellA material you designed app for your ADB needs
First release: Jan 16, 2026
Assempix com.aicodix.assempixA coded OFDM update to SSTV to receive digital images over SSB, AM and FM radio
First release: Nov 13, 2025
Assistive Menu Tool com.joaohouto.assistivemenutoolFloating accessibility button with quick system actions for Android
First release: Sep 9, 2026
- Assistral org.shano.assistral
First release: Aug 22, 2025
Aster Mail org.astermail.androidPrivate email app with end-to-end encryption, aliases, and custom domains
First release: Sep 9, 2026
- Asteroid's Revenge! com.game.asteroids_revenge
First release: Jul 25, 2025
AstraCrypt com.nevidimka655.astracryptHide and encrypt your files with modern security standards.
First release: Sep 22, 2025
- Astroclock de.goraran.astroclock
First release: Sep 3, 2026
Astro Loop com.astroloop.gameOpen-source roguelike shooter. Simple to play, no ads, no tracking, offline.
First release: Jul 31, 2026
Astronia com.antoniegil.astroniaLightweight and modern M3U8 video player
First release: Feb 9, 2026
- Astronomy com.vayunmathur.astronomy
First release: Aug 1, 2026
Atalaya cat.naval.atalayaFirst release: Jul 26, 2025
aTalk org.atalk.androidFirst release: Jan 5, 2026
Athena com.kin.athenaFirst release: Jan 18, 2026
Athena dev.sebaubuntu.athenaReview your device's information, from hardware to software.
First release: Oct 17, 2025
- Atmo Engine com.saad_khan_rind.atmosphere_effect
Animated wallpapers with Atmosphere, Glass, Canvas Sketch and playlists.
First release: Aug 19, 2026
- Atmos Weather io.atticusc.atmosweather
First release: Dec 12, 2025
Atomic com.jlindemann.scienceFirst release: Nov 17, 2025
aTox ltd.evilcorp.atoxaTox, a beautiful and modern Tox client
First release: Nov 10, 2024
Atrium app.atriumControl your self-hosted media stack from one app
First release: Aug 1, 2026
- Attendance Tracker com.github.rahul_gill.attendance
First release: Jun 15, 2024
Aucards vadimerenkov.aucardsFirst release: Sep 16, 2025
audav rocks.mm_dev.audavFirst release: Oct 8, 2026
Audile com.mrsep.musicrecognizerMusic recognition app
First release: Sep 12, 2025
AudioAnchor com.prangesoftwaresolutions.audioanchorAudio player that tracks the listening process of your audio books and podcasts
First release: Dec 18, 2025
- Audiobookshelf com.audiobookshelf.app
First release: Sep 4, 2025
AudioLex de.hexenwoche.audiolexHearing training for word recognition: listen, identify, repeat. Fully offline.
First release: Sep 2, 2026
- Audio Output Switcher br.com.wasystems.audiooutputswitcher
First release: Sep 27, 2025
Audio Recorder com.dimowner.audiorecordergives easy audio recording experience
First release: Oct 13, 2024
Audio Share io.github.mkckr0.audio_share_appFirst release: Mar 6, 2025
- Audio Source fr.dzx.audiosource
First release: Jul 21, 2025
- Audio Spectrum Analyzer org.woheller69.audio_analyzer_for_android
First release: Nov 7, 2025
- Audio Visualizer io.github.rinoprogram.audiovisualizer
First release: Jul 31, 2026
- Audire com.alexmercerind.audire
First release: Nov 1, 2025
Auraninja io.github.giuig.auraninjaFirst release: Jul 28, 2026
AuraOrbit dev.jaimin.auraorbitInteractive 3D sphere live wallpaper with Fibonacci app distribution.
First release: Oct 25, 2026
Aurora Droid com.aurora.adroidAnother FOSS client for F-Droid
First release: Aug 10, 2026
Aurora Store com.aurora.storeAn unofficial FOSS client to Google Play with an elegant design and privacy
First release: Aug 19, 2025
AusweisApp com.governikus.ausweisapp2ePerso mit dem Handy nutzen
First release: Jan 29, 2026
Autasker vadimerenkov.autaskerFirst release: Oct 8, 2026
Authenticator com.bitwarden.authenticatorFirst release: Dec 13, 2024
- Authnkey pl.lebihan.authnkey
First release: Jan 13, 2026
AuthPass SL design.codeux.authpass.sideloadFirst release: Feb 4, 2024
auth's RNG com.ivylopez.authsrngroll for rarities, sell them, buy upgrades. an incremental RNG game.
First release: Aug 26, 2026
Auto Auto-Rotate com.jarsilio.android.autoautorotateAutomatically remembers your auto-rotate setting for every app
First release: Apr 13, 2025
- AutoDND moe.dic1911.autodnd
First release: Aug 25, 2025
Auto Light com.mine.autolightFirst release: Dec 31, 2025
- Automatic Advanced Settings Expander de.binarynoise.AutomaticAdvancedSettingsExpander
First release: Feb 26, 2022
- Automation com.jens.automation2
First release: Aug 26, 2026
Autometer com.vtrackTrack fuel economy and vehicle maintenance schedules
First release: Sep 18, 2026
- Auto Mute xyz.sommd.automute
First release: Jan 18, 2025
Auto Off Bluetooth com.mine.autooffbluetoothFirst release: Jan 5, 2026
AutoPie com.autopiTurn Linux commands into Android apps.
First release: Jun 25, 2026
- AutoPie com.autosec.pie
First release: Aug 15, 2025
- Auto Shine com.mine.autoshine
First release: Jun 23, 2025
- Auto Sleep com.mine.autosleep
First release: Jan 23, 2026
Autu Mandu org.juanro.autumanduFirst release: Aug 27, 2025
- Auvae de.attarsherz.auvae
First release: Sep 29, 2026
Auxio org.oxycblt.auxioA simple, rational music player
First release: Jul 11, 2025
- Avare com.ds.avare
First release: Oct 30, 2025
- Average data usage widget com.trianguloy.continuousDataUsage
First release: Oct 30, 2024
Aves deckers.thibault.avesFirst release: Sep 8, 2025
- Aves Libre deckers.thibault.aves.libre
Gallery and metadata explorer
First release: Oct 18, 2026
AVNC com.gaurav.avncFirst release: Sep 22, 2025
AVR-Remote de.pskiwi.avrremoteFirst release: Aug 8, 2026
AWAGAM com.awagam.androidBlock TLDs and domains at the DNS level using your own blocklists
First release: Sep 27, 2026
AwakeOnLANMobile com.awakeonlanmobileSend WakeOnLAN packets (IPv4/IPv6) over the internet, includes a CIDR scanner
First release: Sep 3, 2025
AwayDoomscrollin' com.resolvecommunity.awaydoomscrollinBreak the scrolling loop on Instagram, TikTok and YouTube
First release: Oct 16, 2026
Awery com.mrboomdev.aweryFirst release: May 12, 2024
- Awery Beta com.mrboomdev.awery.beta
First release: Jun 29, 2024
Axichat im.axi.axichatReplace your email, messenger, and calendar with one app.
First release: Oct 8, 2026
Aya com.quran.ayaOffline Quran with 10 Qira'at, Hadith, prayer times, adhan, azkar & qibla.
First release: Sep 27, 2026
Ayni nz.diaswarm.ayniSee the glucose of someone who shares it with you
First release: Oct 25, 2026
- Azahar io.github.lime3ds.android
First release: Sep 16, 2025
- Azahar org.azahar_emu.azahar
First release: Mar 26, 2026
- Azi Demo io.github.fm_elpac.azi_demo
First release: Aug 27, 2025
BabbyPaint dev.alexjyong.babbypaintSimple little paint application for kids.
First release: Dec 6, 2024
- Baby Book com.serwylo.babybook
First release: Jul 13, 2023
- Baby Buddy eu.pkgsoftware.babybuddywidgets
First release: Dec 16, 2025
- Baby Dots com.serwylo.babydots
First release: Jul 16, 2024
Baby Monito com.baldo.babymonitoFirst release: Sep 26, 2026
- Baby Name fr.hnit.babyname
First release: Sep 21, 2025
- Baby Phone com.serwylo.babyphone
First release: Jul 30, 2024
Baby Touch Lock com.babytouchlockBlock accidental touches, gestures and buttons while your kid watches videos
First release: Sep 23, 2026
- BackgroundWorkAround background.work.around
First release: Aug 7, 2026
Backlog Tracker com.debojitsantra.backlogtrackerTrack study, work, games, habits, and anything that piles up.
First release: Jul 29, 2026
Backtalk off.kys.backtalkMessage yourself to stay organized.
First release: Oct 8, 2026
- Backup org.secuso.privacyfriendlybackup
First release: Dec 4, 2024
Badge Magic org.fossasia.badgemagicFirst release: Aug 25, 2025
Bag app.bitbagWatch-only Bitcoin tracker: xpub, Bitkey multisig, widget. Private, no ads.
First release: Aug 7, 2026
- Bahn-Vorhersage de.bahnvorhersage.app
First release: Jan 11, 2026
- Baker's Percentage Calculator com.pep1lo.bakerspercentagecalculator
First release: Jul 31, 2026
Balance com.ashkanrafiee.balancePrivate offline bank balance dashboard
First release: Sep 3, 2026
Ball2Box com.salvai.ultimatetossFirst release: Dec 30, 2024
- Ball2Box com.simondalvai.ball2box
First release: Oct 26, 2025
- BallBreak de.georgsieber.ballbreak
First release: Jul 16, 2025
Baluchon com.baluchon.appShare expenses: trips with friends, or kids' costs between separated parents
First release: Jul 31, 2026
Baly Groceries Tracker com.baly_groceries_tracker.appFirst release: Aug 31, 2026
- Banana Split com.nfcarchiver.banana_split
First release: Aug 2, 2026
Bangle.js Gadgetbridge com.espruino.gadgetbridge.banglejsAndroid companion app for Bangle.js built on top of the Gadgetbridge project.
First release: Feb 8, 2026
Bangumi com.czy0729.bangumiA third-party client for Bangumi
First release: Sep 17, 2025
- Barcode Buddy Scanner de.bulling.barcodebuddyscanner
First release: Aug 27, 2024
Barcode Scanner com.atharok.barcodescannerAn open-source app that allows you to read and generate barcodes.
First release: Nov 15, 2025
baresip com.tutpro.baresipFirst release: Sep 13, 2025
baresip+ com.tutpro.baresip.plusVoIP and mobile calling and messaging app based on baresip library
First release: Feb 5, 2026
barlog dev.keiver.barlogFirst release: Apr 28, 2025
Baseline io.github.anrinion.baselineGentle self-care for depression, disability, chronic illness, or burnout
First release: Oct 8, 2026
- BasicCashFlow org.eagsoftware.basiccashflow
First release: Jan 13, 2026
- BasicSync com.chiller3.basicsync
A simple app for running Syncthing on Android
First release: Mar 30, 2026
- Basque for AnySoftKeyboard com.anysoftkeyboard.languagepack.basque
First release: Jul 31, 2026
Bati com.guiforge.batiTurn workouts into quests, boss fights and a village built by your training.
First release: Aug 21, 2026
- Batt com.porg.batt
First release: Oct 10, 2024
Battarang com.anissan.battarangFirst release: Sep 15, 2025
- Battery Charge Limiter io.github.muntashirakon.bcl
First release: Jul 5, 2024
- Battery Monitor codes.swistak.batterymonitor
Monitor your device's battery status in detail in real time
First release: Aug 1, 2026
- Battery Notification com.ominous.batterynotification
First release: Jun 18, 2025
- BatteryTemperature barilyuk.batterytemperature
First release: Dec 15, 2025
- Battery Tile com.cominatyou.batterytile.standalone
First release: Aug 1, 2025
- Battery Tile net.pgaskin.batterytile
First release: Aug 11, 2026
Battle for Burgers org.xolatgames.burgersAn Online-Multiplayer game. Collect so much more burgers as you can.
First release: Oct 8, 2026
Battleship com.cocode.battleshipOffline naval combat against an AI opponent, with no ads and no account
First release: Sep 23, 2026
- Battleships org.secuso.privacyfriendlybattleship
First release: Jan 17, 2026
BayesianBahn io.github.derweh.bayesianbahnEmpirical arrival-time distributions for Deutsche Bahn trains
First release: Aug 21, 2026
- Bazarnote com.rootminusone8004.bazarnote
First release: Mar 10, 2025
BCR-GUI com.github.nicorac.bcrguiFirst release: Sep 24, 2025
Beam montafra.beamLive battery metrics pinned to your status bar
First release: Aug 17, 2026
Beanbook io.github.pintofi.beanbook.expertPlain-text accounting for Beancount, on your phone, with no account.
First release: Oct 18, 2026
Beans net.helcel.beansFirst release: Nov 9, 2024
BeatBridge com.beatbridgeAuto-play music when your Bluetooth car, headphones, or speakers connect.
First release: Aug 5, 2026
Beat Feet com.serwylo.beatgameJump through cities generated to the beat of the music.
First release: Jul 23, 2024
- BeatInspector io.github.leonidius20.beatinspector
First release: Jun 17, 2024
BeauTyXT dev.soupslurpr.beautyxtFirst release: Sep 11, 2025
- BedrockStation me.sergiotarxz.bedrockstation.pro
First release: Jul 31, 2026
- BeeCount com.knirirr.beecount
First release: Feb 6, 2026
- Belarusian for AnySoftKeyboard com.anysoftkeyboard.languagepack.belarusian
First release: Jul 31, 2026
Bematist app.bematist.publicMatches your local music's BPM to your running cadence in real time
First release: Oct 12, 2026
BendyStraw rocks.mm_dev.BendyStrawFirst release: Dec 10, 2025
Be nice de.thomaskuenneth.beniceModern aesthetics. Open-source soul. Your Android launcher.
First release: Mar 18, 2026
Berlin-Vegan org.berlin_vegan.bvappFirst release: Aug 17, 2020
Besser Bahn dev.chuk.betterbahnFirst release: Sep 22, 2025
- Better Bluetooth device sort de.binarynoise.betterBluetoothDeviceSort
First release: Jul 31, 2026
BetterCounter org.kde.bettercounterA simple, multi-purpose counter app
First release: Jul 2, 2025
- Better Internet Tiles be.casperverswijvelt.unifiedinternetqs
First release: May 12, 2025
- Better Network Tiles me.d3sox.betternetworktiles.libre
First release: Mar 19, 2024
- Better schedule cz.vitskalicky.lepsirozvrh
First release: May 11, 2025
Better Stundenplan in.eike.better_stundenplanFirst release: Aug 28, 2025
- BetterUntis com.sapuseven.untis
First release: Nov 6, 2023
- Better verbose Wi-Fi logging de.binarynoise.betterVerboseWiFiLogging
First release: Jul 31, 2026
- BFBAN Assistants com.cabbagelol.bfban
First release: Mar 29, 2023
BFP Calculator eu.mirkodi.bfpcalculatorFirst release: May 5, 2024
- bgammon com.rocket9labs.boxcars
First release: Jun 19, 2025
- BG Clock nl.hansdezwart.bgclock
First release: Aug 14, 2026
- Bhagavad Gita com.wirelessalien.android.bhagavadgita
First release: Jun 25, 2025
- Bibledit org.bibledit.android
First release: Dec 21, 2025
- Bible Feed com.me2christ.bible_feed
First release: Sep 15, 2025
Bible Feed com.risencode.bible_feedFirst release: Jul 15, 2026
- BibleLockScreen com.daklok.biblelockscreen
Daily Bible verse on your lock screen wallpaper
First release: Aug 28, 2026
Bible Notify com.biblenotify.biblenotifyFirst release: Apr 17, 2026
- Bible Notify com.correctsyntax.biblenotify
First release: Oct 29, 2025
- BibleSide com.bibleside.bibleside
First release: Dec 31, 2024
Bible Study net.bible.android.activityFirst release: Aug 28, 2025
Bible Verse App ch.joshuah.bibleverseappDaily Bible verses from BibleGateway.com with widgets & notifications
First release: Oct 25, 2025
- bicyweather de.phasenrauscher.bicyweather
First release: Jan 20, 2025
- Bide et Musique fr.odrevet.bide_et_musique
First release: Aug 14, 2025
BikeBridge dev.bg.bikebridgeCompanion app for e-bikes and components
First release: Nov 21, 2025
Bike Radar es.jjrh.bikeradarOverlay and audio alerts for BLE bike radars. Offline, no account, no cloud.
First release: Aug 21, 2026
- BikeSharingHub fr.fdesousa.bikesharinghub
First release: Jul 15, 2025
BikeTrackd com.biketrackd.appA cycling speedometer and GPS tracker with offline maps and bike maintenance
First release: Aug 11, 2026
- BILIBILIAS com.imcys.bilibilias
First release: Jul 31, 2026
BiliDownOut cn.a10miaomiao.bilidownExport videos downloaded from the Android version of Bilibili App
First release: Oct 28, 2024
bilimiao com.a10miaomiao.bilimiaoOriginal Bilibili Time Machine
First release: Nov 16, 2025
Bily com.bilyAids in splitting shared receipts fairly
First release: Aug 25, 2025
Bim! bim.appFirst release: Aug 31, 2025
- Bimba xyz.apiote.bimba.czwek
First release: Nov 18, 2025
Binary Puzzle com.sidhant.binarypuzzleA minimalist binary placement logic puzzle game.
First release: Sep 23, 2026
Binaural Beat com.binauralbeatBinaural beat generator with the classic SBaGen engine and ambient backgrounds
First release: Oct 8, 2026
BinClockWidget fr.shiningcat.binclockwidgetAMOLED-black monochrome binary-clock home-screen widget
First release: Aug 4, 2026
BinEd org.exbin.bined.editor.androidEditor for binary data (hex viewer/editor)
First release: Jun 19, 2025
- Biometric Bypass eu.rafareborn.biometricbypass
First release: Apr 24, 2025
- Birday com.minar.birday
First release: Aug 17, 2024
Birdipedia de.katzenmue.birdipediaA pocket bird guide written in Jetpack Compose.
First release: Oct 26, 2025
- Birthday Adapter org.birthdayadapter
First release: Jan 15, 2026
- Birthday Countdown de.drmaxnix.birthdaycountdown
First release: Jul 31, 2026
bisonrelay org.bisonrelay.bruigFirst release: Feb 20, 2025
Bisq Connect network.bisq.mobile.clientFirst release: Nov 23, 2025
Bisq Easy network.bisq.mobile.nodeFirst release: Sep 5, 2025
- BitAC ademar.bitac
First release: Jan 19, 2026
BitBanana app.michaelwuensch.bitbananaFirst release: Sep 5, 2025
BitBoxApp ch.shiftcrypto.bitboxappFirst release: Jul 25, 2025
- Bitcoin Ticker dev.steamy.bitcointicker
Ad-free Bitcoin home-screen widget: EUR/USD price, 24h change and charts
First release: Oct 3, 2026
- Bitcoin Wallet de.schildbach.wallet
First release: Mar 8, 2025
- Bitcoin Wallet [testnet3] de.schildbach.wallet_test
First release: Jul 31, 2026
Bitkey world.bitkey.appFirst release: Sep 15, 2025
- Bitkit to.bitkit
First release: Sep 2, 2025
Bitmask se.leap.bitmaskclientFirst release: Oct 8, 2026
Bitscoper CyberKit bitscoper.bitscoper_cyberkitFirst release: Aug 25, 2026
BkEmu su.comp.bkElektronika BK-0010/11M Emulator
First release: Apr 1, 2025
BLACKBOX com.blackbox.appFile Encryption & Vault
First release: Sep 23, 2026
- BlackCandy org.blackcandy.android
First release: May 28, 2024
- BlackCandy org.blackcandy.androidApp
First release: May 12, 2026
- Blade Player v.blade
First release: Dec 17, 2023
BlastOff com.ranger.blastoffFirst release: Oct 8, 2026
BLE Manager net.satka.bleManagerFirst release: Mar 1, 2025
BleOta com.vovagorodok.ble_ota_appFirst release: Oct 14, 2024
- BLE Radar f.cking.software.debug
First release: Jan 10, 2026
- BLEtoMQTT com.CasparvdBroek.bletomqtt
First release: Jul 15, 2025
Blichess com.vovagorodok.blichessPlay lichess games over Bluetooth
First release: Jan 2, 2026
Blidraughts com.vovagorodok.blidraughtsPlay draughts games over Bluetooth
First release: Jan 2, 2026
Blink Comparison org.proninyaroslav.blink_comparisonSimplifies comparing photos of tamper-evident seals using your eyes
First release: Oct 22, 2024
- Blitz net.leodesouza.blitz
First release: May 12, 2025
- Blitzortung Lightning Monitor org.blitzortung.android.app
First release: Nov 29, 2025
- Blixt Wallet com.blixtwallet
First release: Sep 4, 2024
BlockAds app.pwhs.blockadsBlock ads & trackers system-wide. Firewall, SafeSearch, profiles
First release: Oct 4, 2026
Block Blast com.sidhant.blockblastA minimal, privacy-focused block puzzle game
First release: Aug 4, 2026
- Block'Buster org.asafonov.blockbuster
First release: May 8, 2024
Block Drop com.blockdrop.gameFree and open source block-stacking puzzle game. Arrange falling shapes to clear
First release: Dec 18, 2025
Blocker com.merxury.blockerA component controller for Android applications
First release: Oct 19, 2025
Block Night pt.tiago.blocknightOffline falling blocks: 600 certified floors, daily challenge, Marathon and Zen
First release: Oct 12, 2026
- Blokada 5 org.blokada.alarm.dnschanger
First release: May 25, 2023
- Blokada 5 org.blokada.origin.alarm
First release: May 25, 2023
- Blokish org.scoutant.blokish
First release: Oct 25, 2024
Blood pressure app com.derdilla.bloodPressureAppFirst release: Aug 27, 2025
Bloom com.rrajath.groveA native Org-mode notes app for Android. Your notes stay plain .org files.
First release: Oct 15, 2026
Bloomee ls.bloomee.musicplayerFirst release: Dec 1, 2025
- Blorp xyz.blorpblorp.app
First release: Sep 18, 2025
BlowTorch 2 com.resurrection.blowtorch2BlowTorch 2 — a versatile mobile MUD client
First release: Sep 11, 2026
- Bluecheese com.msb.bluecheese
First release: Oct 16, 2025
- BlueGate org.cleverfox.bluegate
First release: Aug 3, 2026
Blue Line Console net.nhiroki.bluelineconsoleFirst release: Jun 6, 2025
- Blue Line Solar Info net.nhiroki.bluelinesolarinfo
First release: Jul 31, 2026
Bluemoon ch.nilsgrob.android.bluemoonOpen source, privacy friendly menstruation tracking app. Your period, your data!
First release: Aug 5, 2025
Bluesky xyz.blueskyweb.appFirst release: Sep 5, 2025
Bluesky Redirect io.github.turtlepaw.blueskyredirectFirst release: Jan 31, 2026
BlueSound Controller com.bluesound.bluesoundplayerFirst release: Aug 23, 2026
Blue Square Speedometer net.nhiroki.bluesquarespeedometerSimple speedometer & GPS viewer
First release: Jun 6, 2025
- Bluetooth GNSS com.clearevo.bluetooth_gnss
First release: Aug 19, 2025
- Bluetooth LE Spam de.simon.dankelmann.bluetoothlespam
First release: Jan 22, 2025
- Bluetooth Remote io.github.jqssun.btremote
First release: Oct 8, 2026
Bluetooth Volume Manager eu.darken.bluemusicIndividual voice & music volume configuration for Bluetooth devices.
First release: Feb 9, 2026
Bluke dev.arnv.blukeUse your phone as a Bluetooth keyboard, gamepad, trackpad, and media remote
First release: Oct 8, 2026
- Blurred Lines Live Wallpaper cxa.lineswallpaper
First release: Jul 31, 2026
Board Game Clock org.secuso.privacyfriendlyboardgameclock(SECUSO) Boardgame Clock offers timers for boardgame time tracking
First release: Feb 4, 2026
Boardgame Pal – Free Toolkit de.schwarz.boardgamepalDice, score counter, starting-player draw & more – 100% free and ad-free!
First release: Aug 23, 2026
BoatSpeedy de.kewl.boatspeedyGPS speedometer and waterway navigation for boats, with battery analytics
First release: Sep 17, 2026
BoB com.baldo.bobFirst release: Sep 14, 2025
- BobBall org.bobstuff.bobball
First release: Aug 31, 2024
BodyCheck com.bodycheckScan and visualize body composition QR codes from your gym
First release: Oct 7, 2026
- BOINC edu.berkeley.boinc
First release: Nov 24, 2025
Boky Fivavahana Anglikana com.uli.bokyfivavahana2Madagascar's Anglican common prayer book app
First release: Sep 3, 2026
- Bold Wallet com.boldwallet
First release: Aug 1, 2025
Boltcard NFC Programmer com.lightningnfcappFirst release: Sep 3, 2024
Boltcard Tools Terminal org.boltcardtools.terminalFirst release: May 26, 2024
- Bolt Card Wallet com.boltcard.boltcard
First release: Aug 14, 2023
- BoltOn com.matt.bolton
First release: Feb 6, 2025
- BombusMod org.bombusmod
First release: Jul 1, 2025
Bona vortaro io.github.kotchwane.bonavortaroEsperanto dictionary, with the whole Reta Vortaro, offline
First release: Oct 12, 2026
Bondwidth com.phonepvr.friendsPrivate, offline phone & contacts app that helps you keep up your bonds
First release: Oct 2, 2026
- BonjourBrowser de.wellenvogel.bonjourbrowser
First release: Mar 21, 2021
Bonjour WebRTC com.github.warren_bank.bonjour_webrtcFirst release: Feb 4, 2026
Bookaccio com.bugsdev2.bookaccioFirst release: Jan 21, 2025
- Bookmarks com.github.warren_bank.bookmarks
First release: Feb 3, 2026
BookOrbit com.bookorbitYour self-hosted ebook & audiobook library client.
First release: Oct 24, 2026
Book's Story ua.acclorite.book_storyDive into the world of adventure as you discover your favorite book's story!
First release: Apr 26, 2025
- BookStash com.bookstash.app
First release: Sep 9, 2026
Bookwyrm nl.privacydragon.bookwyrmA BookWyrm client for Android.
First release: Jan 23, 2025
Booming Music com.mardous.boomingFirst release: Nov 11, 2025
- BOOM Switch com.github.shingyx.boomswitch
First release: Nov 4, 2025
Boop com.derpbiscuit.boopPop a nearby person’s bubble. A tiny Boop over Bluetooth, with no Internet
First release: Oct 13, 2026
Bosun com.bosun.appConfigure MIDI Captain pedals from your phone
First release: Oct 13, 2026
- Bote com.bote.app
First release: Aug 4, 2026
Bouncing Logo org.inretio.bouncinglogoFirst release: Oct 8, 2026
- Bouncy io.github.ebraminio.bouncy
First release: Jul 31, 2026
BoutScoring com.razielo.boutscoringApp for Scoring Combat Sports Bouts
First release: Feb 1, 2026
Box, Box! org.brightdv.boxboxUnofficial app for Formula 1 and Formula E fans!
First release: Nov 8, 2025
Box Breathing dev.cosmoslab.boxbreathingLightweight 50 KB box breathing timer that ticks the seconds out loud
First release: Oct 11, 2026
BoxingClock com.antoinelabpixel.boxingclockInterval timer for boxing training with audio cues and configurable rounds.
First release: Oct 7, 2026
boxorg io.gothub.boxorgDeclutter meditatively — photograph, frame, pack, find it again.
First release: Sep 20, 2026
Box Smasher se.voxelmanip.boxsmasherFirst release: Feb 11, 2025
- Braille Keyboard com.lukeneedham.braillekeyboard
First release: Jan 22, 2024
Braincup com.inspiredandroid.braincupTrain your focus, memory and math skills.
First release: Jul 29, 2026
- Brainf com.fredhappyface.brainf
First release: Aug 26, 2024
- Brave Nightly com.brave.browser_nightly
First release: Nov 6, 2025
- BravePipe com.github.bravenewpipe
First release: Feb 8, 2025
- Brazilian Portuguese for AnySoftKeyboard com.anysoftkeyboard.languagepack.brazilian
First release: Jul 31, 2026
Break.Down.Timer de.jepfa.bdtFirst release: Jan 17, 2026
Breakout 71 me.lecaro.breakoutBreak colourful bricks, catch bouncing coins and select powerful upgrades !
First release: Feb 8, 2026
BreakThrough com.halftab.breakthroughOffline side-scrolling glass-breaking game
First release: Oct 11, 2026
Breathly com.mmazzarolo.breathlyFirst release: Oct 8, 2026
- Breez com.breez.client
First release: Jan 14, 2025
Brethap com.jithware.brethapControl your breathing during meditation.
First release: Jan 7, 2026
Brevier io.github.gurov.brevierA reading browser: the web without JavaScript, set in your own type
First release: Oct 13, 2026
brezavta.si si.brezavta.mobileFirst release: Oct 19, 2026
Briar org.briarproject.briar.androidSecure messaging, anywhere
First release: Dec 2, 2025
Briar Mailbox org.briarproject.mailboxFirst release: Oct 8, 2026
- Bribri for AnySoftKeyboard com.anysoftkeyboard.languagepack.bribri
First release: Jul 31, 2026
Brick Blast com.mostafa.brickblastFirst release: Jul 30, 2026
BroadBoard com.galagidae.broadboardLarge, high-contrast on-screen keyboard designed for low vision users
First release: Aug 12, 2026
- Broccoli com.flauschcode.broccoli
First release: Oct 28, 2025
Brogue CE org.broguece.gameFirst release: Jul 28, 2026
- Broker 1961 eu.veldsoft.broker
First release: Feb 11, 2024
- BRouter btools.routingapp
First release: Jul 24, 2025
- Brownian Particles Wallpaper io.github.dergenaue.brownianparticles
First release: Jan 5, 2026
- Bru works.bru
First release: Sep 16, 2026
Bruce App bruce.appCompanion App for interacting with Bruce Firmware
First release: Aug 2, 2025
- Brume Wallet eth.brume.wallet
First release: Feb 2, 2025
BT Remote com.atharok.btremoteBluetooth remote control for Android TV.
First release: Jan 4, 2026
BT Scanner dev.fabik.bluetoothhidFirst release: Jan 21, 2026
BTT Recorder bible.translationtools.recorderFirst release: Apr 7, 2025
- Bubble org.woheller69.level
First release: Sep 1, 2025
Bubble2 com.github.edeso.bubble2Comic book reader, Image archive viewer. Simple yet comfy.
First release: Jan 27, 2026
Bubble Night pt.tiago.bubblenightOffline bubble shooter: 600 certified levels, daily challenge, Endless and Zen
First release: Oct 12, 2026
Bubble Notice io.github.gracethings.bubblenoticeA lightweight bubble notice tool, providing more intuitive notifications for the
First release: Jul 28, 2026
- Bubble Penetration org.codeberg.scovillo.bubble
First release: Aug 26, 2026
Bubble Shooter com.sidhant.bubbleshooterA modern 2D bubble shooter puzzle game
First release: Sep 9, 2026
- Buckwheat com.danilkinkin.buckwheat
First release: Aug 24, 2025
Budget Lens com.budget.lensSmart personal budget tracker with dynamic daily allowance and privacy first.
First release: Feb 9, 2026
- Bugbane org.osservatorionessuno.bugbane.beta
First release: Aug 31, 2026
- Bugdroid buddy ca.rmen.nounours.lwp.robot
First release: Aug 2, 2026
- Bulgarian for AnySoftKeyboard com.anysoftkeyboard.languagepack.bulgarian
First release: Jul 31, 2026
Bunny Media Editor eu.artectrex.bunnyMedia editor: edit images and videos on your phone
First release: Apr 15, 2025
Bura com.davidtakac.buraModern weather app with graphs and thoughtful data visualization
First release: Jul 7, 2025
Burger Party com.agateau.burgerpartyAre you fast enough to put together the burgers ordered by your customers?
First release: Jul 29, 2025
Burkan io.github.barqallayl.burkanKeeps your Galaxy S23 on the Vulkan renderer, even after a restart
First release: Oct 21, 2026
BurnPony com.burnpony.androidSelf-destructing encrypted notes. The recipient just opens a link.
First release: Aug 1, 2026
- Buses org.billthefarmer.buses
First release: Sep 24, 2021
BusTO it.reyboz.bustorinoBusTO gives you arrival times for public transport in Turin and its outskirts
First release: Sep 26, 2026
Butterfly dev.linwood.butterflyFirst release: Oct 21, 2021
Butterfly Nightly dev.linwood.butterfly.nightlyTake notes, draw freely, and organize ideas across an endless workspace
First release: Feb 4, 2026
BuzzKill ca.asmat.buzzkillPowers off your phone after inactivity, only inside a nightly kill zone.
First release: Oct 8, 2026
BVD cc.kafuu.bilidownloadbilibili video resource downloader
First release: Jan 5, 2026
bVNC Free com.iiordanov.freebVNCFirst release: Oct 8, 2026
ByeByeDPI io.github.romanvht.byedpiBypass censorship on Android
First release: Jul 1, 2025
- ByeDPI io.github.dovecoteescapee.byedpi
First release: Aug 23, 2024
C2K com.hackerapps.c2kOffline C25K & C210K trainer with voice coaching. No ads, no tracking.
First release: Jul 29, 2026
- c3nav de.c3nav.droid
First release: Dec 22, 2025
- c3nav (debug) de.c3nav.droid.debug
First release: Aug 3, 2026
CableSnap com.persoack.cablesnapWorkout tracker for cable machine workouts
First release: Oct 21, 2026
Cache Cleaner com.github.bmx666.appcachecleanerClean cache of installed user and system apps using Accessibility
First release: Jul 2, 2025
- CacheCleanerWidget com.zinaro.cachecleanerwidget
First release: May 6, 2025
Caff cc.goll.caffFirst release: Dec 18, 2025
- Caffeinate com.hifnawy.caffeinate
First release: Dec 8, 2025
Caffeine Health com.uc.caffeineTrack your caffeine. Protect your sleep. Real-time pharmacokinetic curves.
First release: Sep 14, 2026
Cairn com.luminaapps.cairnAggregate your health data into open files in your own Nextcloud
First release: Aug 27, 2026
CairnGPS app.matthieu.cairngpsHike tracking, live GNSS satellite view, achievements. Works fully offline
First release: Oct 20, 2026
CajuScan com.marotoweb.cajuscan_appRecord invoices in the Cashew app by scanning the QR code on Portuguese invoices
First release: Jul 30, 2026
Calculate com.rechnen.appFirst release: Sep 25, 2025
Calculator app.myzel394.numberhubYour Hub for Math / Currency rates / Date calculations / Time zones...
First release: Oct 23, 2024
Calculator com.capybara.calculatorFirst release: Nov 18, 2023
- Calculator com.darkempire78.opencalculator
First release: Sep 21, 2025
Calculator com.dumberkit.calculatorCalculator and unit converter for keypad phones, typed on the keypad
First release: Oct 10, 2026
- Calculator com.marktka.calculatorYou
First release: Jan 18, 2025
- Calculator com.sadellie.unitto
First release: Feb 9, 2026
Calculator com.vagujhelyigergely.calculatorm3First release: Oct 8, 2026
- Calculator devs.org.calculator
First release: Jul 11, 2025
Calculator org.fossify.mathSimple and open-source calculator for quick and easy calculations
First release: Jul 5, 2025
CalcYou net.youapps.calcyouPrivacy Focused Calculator app built with MD3
First release: Sep 23, 2025
Calendar com.vayunmathur.calendarFirst release: Jan 7, 2026
Calendar org.fossify.calendarFirst release: Sep 1, 2025
- Calendar Color ch.ihdg.calendarcolor
First release: Aug 6, 2024
- Calendar Import-Export org.sufficientlysecure.ical
First release: Sep 22, 2024
Calendula de.jeanlucmakiola.calendulaA Material 3 Expressive calendar for Android with no network access.
First release: Aug 1, 2026
Calibre Web Companion de.doen1el.calibreWebCompanionFirst release: Jul 16, 2025
Calisthenics Memory io.github.gonbei774.calisthenicsmemoryBodyweight workout tracker - create and customize your own exercises
First release: Feb 11, 2026
Call Blocker com.callblockerBlock unwanted calls, spam and telemarketing
First release: Oct 12, 2026
- CallForwardingStatus de.kaiserdragon.callforwardingstatus
First release: Dec 7, 2024
- Calliope mini cc.calliope.mini
First release: Nov 4, 2025
- Call Limiter com.thirumalai.calllimiter
First release: Jan 31, 2026
CallScope com.clintmoyer.callscopeLocal-first call log analytics
First release: Oct 7, 2026
Calories AI com.anonymous.caloriefromphotoaiFirst release: Dec 19, 2024
CalSync dev.henriquecouto.calsyncFirst release: Aug 4, 2026
- Calyx com.gurkenwerfer.calyx
First release: Jul 31, 2026
Calyx VPN org.calyxinstitute.vpnFree VPN Service offered by The Calyx Institute
First release: Apr 13, 2025
Camera app.grapheneos.cameraFirst release: Oct 1, 2025
- Camera com.vayunmathur.camera
First release: Jul 29, 2026
Camera org.fossify.cameraLightweight open-source camera app for quick, easy, and secure photography
First release: Sep 17, 2025
CameraAlign org.jshobbysoft.cameraalignFirst release: Jul 13, 2025
- Camera Date Folders de.kromke.andreas.cameradatefolders
First release: Aug 27, 2025
- CameraFileCopy org.cimbar.camerafilecopy
First release: Jan 27, 2026
Camera Silencer dev.serika.camerasilencerReduce camera audio only while a camera is active
First release: Oct 15, 2026
- Camera Silencer Diagnostic dev.serika.camerasilencer.diagnostic
First release: Oct 14, 2026
CamEscape com.one37view.camescapeMap surveillance cameras from OpenStreetMap and plan routes that avoid them
First release: Oct 13, 2026
Cams com.vladpen.camsSimple RTSP viewer for IP cameras
First release: Oct 25, 2025
- camsung android.com.ericswpark.camsung
First release: May 20, 2025
Candle com.elasticrock.candleFirst release: Sep 6, 2025
- CanIWebView com.caniwebview.android
First release: Oct 2, 2025
Canta io.github.samolego.cantaFirst release: Sep 26, 2025
Captain qBit dev.acamol.qbitControl your qBittorrent server from your phone
First release: Jul 31, 2026
- CaptainsLog com.frabon.captainslog
Your Personal Log for Navigating the Inner Cosmos
First release: Oct 3, 2026
CaptureCap com.yepgoryo.CaptureCapFirst release: Aug 5, 2026
CaptureSposed com.keshav.capturesposedBlock Android's Screenshot and Screen Recording Detection APIs
First release: Feb 20, 2025
- Capy Nightly com.capyreader.app.nightly
First release: Feb 11, 2026
Capy Reader com.capyreader.appFirst release: Sep 22, 2025
- Carburoid net.canvoki.carburoid
First release: Feb 8, 2026
Car Coop net.carcoop.appSelf-hosted car sharing companion for bookings, trips, expenses, and messages.
First release: Sep 3, 2026
Cardabase com.georgeyt9769.cardabaseLightweight digital wallet to securely scan, store, and manage loyalty cards off
First release: Sep 11, 2025
- Cardboard Museum com.example.forgottenumbrella.cardboardmuseum
First release: Apr 3, 2024
Cards With Cats com.dozingcatsoftware.cardswithcatsPlay Hearts, Spades, and duplicate bridge with cat opponents and partners
First release: Sep 11, 2026
Carfoin com.github.webierta.carfoinInvestment Fund Portfolio Manager
First release: Aug 5, 2024
- Carrion us.spotco.carrion
First release: Dec 9, 2024
Carta com.innomatic.cartaappFirst release: Jul 7, 2024
Cartes IGN fr.ign.geoportailDiscover France another way and witness the land's evolution
First release: Feb 10, 2026
CarVita com.wangjinli.carvitaPersonal assistant for managing and predicting your vehicle's maintenance needs.
First release: Jun 26, 2025
Cascada com.game.CascadaCasual logic game with marbles for two players
First release: Oct 8, 2026
CashCompass com.tuhin.cash_compassFirst release: Mar 17, 2024
Cashiro com.ritesh.cashiroAll-In-One Expense-Budget tracker for bank SMS and PDF statements with optional AI chat & Analysis
First release: Oct 8, 2026
- Cash On Track com.example.financemanager
First release: Jun 24, 2025
Casio G-Shock Smart Sync org.avmedia.gshockGoogleSyncAdd smart functions to your Casio square BT G-Shock Watch.
First release: Feb 2, 2026
CastLab app.fedilab.castlabCast your media to DLNA/UPnP and FCast devices
First release: Jan 19, 2026
- Catalan for AnySoftKeyboard com.anysoftkeyboard.languagepack.catalan
First release: Jul 31, 2026
Cat a shooter org.xolatgames.catashootFirst release: Jan 23, 2026
Cat Hunt io.github.xtratter.cathuntA game for cats: mice, bugs, a fish, a butterfly and a laser dot to catch
First release: Oct 2, 2026
- Catima me.hackerchick.catima
First release: Dec 12, 2024
- CatShare moe.reimu.catshare
First release: Jul 28, 2025
- Cavern Cravers com.game.caverncravers
First release: Jul 31, 2026
- CaveSurvey com.astoev.cave.survey
First release: Mar 27, 2024
Cavity com.louis.app.cavityFirst release: Aug 26, 2025
- cb_app com.theripper.cb_app
First release: Jan 7, 2024
- c-beam org.c_base.c_beam
First release: Oct 30, 2024
CBG Pro com.clavierhaus.gnubgFirst release: Aug 15, 2026
CCDroidX dev.aungkyawpaing.ccdroidxFirst release: Oct 23, 2024
- ccgt de.fff.ccgt
First release: Feb 10, 2026
CClauncher app.cclauncherFirst release: Sep 24, 2025
Ceno ie.equalit.cenoFirst release: Feb 4, 2026
- Centsation com.eipna.centsation
First release: Jun 15, 2025
Cerberus Tiles com.bl4ckswordsman.cerberustilesFirst release: Jul 28, 2025
- Cesium fr.duniter.cesium
First release: Sep 3, 2025
- CEToolbox com.github.cetoolbox
First release: May 20, 2025
- Cfait com.trougnouf.cfait
First release: Feb 24, 2026
c:geo cgeo.geocachingFirst release: Sep 19, 2025
Chaka net.timelegend.chaka.viewer.appCommitted to improving reading experience
First release: Jan 26, 2026
Chaldea cc.narumi.chaldeaFirst release: Sep 22, 2025
- Chaldea cc.narumi.chaldea.fdroid
First release: Jul 31, 2026
Chance com.github.jameshnsears.chanceCreate custom dice with text and SVG faces.
First release: Mar 18, 2025
Chance com.moffatman.chanFirst release: Sep 16, 2025
ChatAir info.flyun.chatairFirst release: Jul 16, 2025
ChatLaunch dev.theolm.wwcStart WhatsApp chats without adding numbers to contacts.
First release: Oct 13, 2025
ChatterUI com.Vali98.ChatterUIFirst release: Sep 8, 2025
- Checkers org.secuso.privacyfriendlydame
First release: Sep 4, 2025
ChemSearch com.furthersecrets.chemsearchSearch compounds, structures, reference and use practical chemistry tools.
First release: Aug 15, 2026
Cheogram com.cheogram.androidFirst release: Oct 7, 2026
Chess com.vayunmathur.games.chessFirst release: Dec 29, 2025
Chess jwtc.android.chessOnline/offline chess with puzzles, Chess960, Duck Chess, and board setup.
First release: Jan 5, 2026
- Chess Clock com.chess.clock
First release: Jan 20, 2025
Chess Puzzles dk.cocode.chessOffline chess tactics from real Lichess puzzles. No account, ads, or tracking
First release: Sep 27, 2026
- Chibe com.jmstudios.chibe
First release: Jul 31, 2026
- Child Monitor de.rochefort.childmonitor
First release: Apr 14, 2024
ChipDefense de.chadenas.cpudefenseA tower defense game with a microprocessor theme
First release: Apr 5, 2025
- ChipDefense: Copper com.rama.chipdefense_copper
First release: Jul 31, 2026
Chitralaya com.akslabs.cloudgalleryTransform Telegram into your personal, unlimited photo cloud storage.
First release: Dec 13, 2025
Chocola com.sosauce.cutemusicChocola is a cute and powerful offline music player app for Android!
First release: Feb 10, 2026
Chogan io.github.choganhq.choganOffline games: chess, sudoku, solitaire, pool, air hockey and more. No ads.
First release: Sep 9, 2026
Chompass app.chompassAd-free AI calorie tracker. Snap, speak, or type meals. Open source.
First release: Aug 10, 2026
Choona com.rohankhayech.choonaGuitar tuner with support for custom tunings.
First release: Sep 10, 2025
Chooser com.uravgcode.chooserFirst release: Aug 29, 2025
- Chooser com.uravgcode.chooserapp
First release: Aug 29, 2025
Chora com.craftworks.musicFirst release: Oct 7, 2026
Chord Progression Helper de.metaviewsoft.chordprogressionhelperFirst release: Aug 8, 2026
- Chord Reader 2 org.hollowbamboo.chordreader2
First release: Jun 1, 2025
- ChromaDoze net.pmarks.chromadoze
First release: Jul 27, 2025
Chroma Launcher com.rcmz.chromalauncherYour home screen, sorted by color. Find any app at a glance.
First release: Oct 3, 2026
- ChromeXt org.matrix.chromext
First release: Aug 11, 2024
Chronal dev.cognitivity.chronalFirst release: Aug 30, 2025
Chrono com.vicolo.chronoModern and powerful clock, alarms, timer and stopwatch.
First release: Jan 5, 2025
Chronofile com.chaidarun.chronofilePersonal time tracking app
First release: Oct 19, 2025
- ChronoRover com.cho3ek89.ChronoRover
First release: Jul 28, 2026
- Chronos com.meenbeese.chronos
First release: Sep 16, 2025
CHRONOS fr.jnda.android.system.smsschedulerSchedule your SMS in advance, without replacing your default messaging app.
First release: Aug 10, 2026
- Chubby Click agrigolo.chubbyclick
First release: Jul 31, 2026
- Cifras o letras org.gnu.itsmoroto.cifrasoletras
First release: Jan 30, 2025
CIFS Documents Provider com.wa2c.android.cifsdocumentsproviderProvides access to shared network storage.
First release: May 12, 2025
- Cigaló net.retiolus.cigalo
First release: Apr 7, 2024
- CineLog com.ulicae.cinelog
First release: Mar 28, 2024
CipherNotes dev.cipher.notesNotes. Encrypted. Local. Nothing more.
First release: Jul 27, 2026
- Circadian Display com.circadiandisplay.app
Adaptive screen warmth and dimming curves for better evening comfort and sleep.
First release: Sep 9, 2026
CircleToSearch com.akslabs.circletosearchCircleToSearch with multi search engine support for all android
First release: Jan 11, 2026
- Circuit Trainer org.secuso.privacyfriendlycircuittraining
First release: Jul 15, 2025
Cirno nep.timeline.cirnoapp freezer to make background apps completely free of CPU resources
First release: Jun 16, 2025
- Cirrus org.woheller69.omweather
First release: Feb 13, 2026
Ciyue org.eu.mumulhl.ciyueA simple mdict dictionary
First release: Feb 10, 2026
- Ciyue org.eu.mumulhl.ciyue.full
First release: Aug 28, 2026
Clash Meta for Android com.github.metacubex.clash.metaA rule-based tunnel
First release: Sep 24, 2025
- Clash Meta for Android Alpha com.github.metacubex.clash.alpha
First release: Feb 11, 2026
- Classic ca.farrelltonsolar.classic
First release: Aug 3, 2024
Classical Music Scanner de.kromke.andreas.mediascannerAuxiliary program for the "Unpopular Music Player" and "Opus 1 Music Player"
First release: Sep 3, 2025
- Classical Music Tagger de.kromke.andreas.musictagger
First release: Sep 23, 2025
- Classic Core com.mobilerpgpack.phone
First release: Sep 6, 2025
- Classic PC Theme com.anysoftkeyboard.theme.classic_pc
First release: Jul 31, 2026
- Classic Power Menu com.kieronquinn.app.classicpowermenu
First release: Oct 17, 2024
Classipod com.adeeteya.classipod🎵 iPod Classic player for local music and Subsonic/Navidrome streaming
First release: Oct 26, 2025
- Clauncher app.clauncher
First release: Jan 19, 2026
Clavier Tuner at.clavierhaus.claviertunerPiano tuning from the piano in front of you: measured, not assumed
First release: Oct 17, 2026
ClaviRom clavirom.keyboardFirst release: Oct 7, 2026
Claw dev.msfjarvis.claw.androidFirst release: Jan 9, 2026
ClawMobile ai.clawmobile.companionFirst release: Sep 9, 2026
- ClayModeller uk.org.retallack.claymodeler
First release: Jul 31, 2026
- Clay Tablet com.mehrphilalethes.claytablet
First release: Mar 26, 2025
CleanShare eu.hxreborn.cleanshareXposed module to clean up Android's Share Sheet
First release: Jan 12, 2026
- CleanSlate com.destructo.botox
First release: Feb 9, 2026
- Clear Clipboard com.amnesica.clearclipboard
First release: May 26, 2023
Clear SMS app.clearsmsPrivacy-first SMS app with smart inbox, finance dashboard and bill reminders
First release: Aug 31, 2026
Clementine Remote de.qspool.clementineremoteMusic player remote control
First release: Oct 2, 2026
Clench net.clench.walletFirst release: Jul 31, 2026
Clerotri app.upryzing.clerotriClient for Upryzing and Revolt/Stoat
First release: Aug 19, 2025
CleverKeys tribixbite.cleverkeysOpen-source gesture keyboard with Termux support
First release: Feb 11, 2026
- Click com.clicc
First release: Aug 29, 2024
Clima co.prestosole.climaBeautiful, minimal, and fast weather app
First release: May 22, 2024
Climb The World com.climbtheworld.appFirst release: Sep 27, 2026
- Clinometer eu.basicairdata.clinometer
First release: Aug 28, 2024
Clio Audiobook Player de.clio.audiobookClean, modern audiobook player for Android focused on privacy and simplicity.
First release: Oct 4, 2026
- Clipeus me.lucky.clipeus
First release: Nov 25, 2025
Clipious com.github.lamarios.clipiousClient for Invidious, the privacy focused YouTube front end.
First release: Sep 13, 2025
ClipShare com.tw.clipshareFirst release: Feb 2, 2026
Cloak com.github.shadowsocks.plugin.ck_clientA Shadowsocks plugin to enhance censorship circumvention
First release: Jul 28, 2025
Clock com.best.deskclockAlarm, clock, timer and stopwatch mode
First release: Sep 21, 2025
- Clock com.vayunmathur.clock
First release: Jul 31, 2026
Clock com.yassineabou.clockan app with timer, stopwatch, sliding clock, and one-time and recurring alarms.
First release: Aug 23, 2024
Clock org.fossify.clockHandy, lightweight, open-source clock app with essential features.
First release: Jul 27, 2025
- Clock systems.sieber.fsclock
First release: Jul 15, 2025
- Clock nightly com.best.deskclock.nightly
First release: Jan 25, 2026
Clockwork io.github.keco216.clockworkOffline 2FA authenticator: TOTP codes, no network permission, no accounts.
First release: Aug 12, 2026
Clock You com.bnyro.clockPrivacy focused clock app build with MD3
First release: Feb 9, 2025
Close Circuit xyz.regulad.closecircuitcreate a PAN surveillance system using WiFi IP Webcams
First release: Jan 30, 2025
- Closet-Archive com.myclosetx
First release: Jun 3, 2024
- Cloudbase Predictor com.cloudbasepredictor
First release: Jul 31, 2026
CloudOTP com.cloudchewie.cloudotpFirst release: Jul 20, 2025
CloudSound ac.amalfi.cloudsoundA service app providing SoundCloud contents to Podcini.A
First release: Sep 18, 2026
CloudStream com.lagradost.cloudstream3Stream and download movies, TV series and anime.
First release: Jul 22, 2025
- CloudStream Beta com.lagradost.cloudstream3.prerelease
First release: Feb 11, 2026
CLT 2026 Schedule info.metadude.android.clt.scheduleFirst release: Feb 13, 2025
cmus net.pgaskin.cmus.androidLightweight music player with touch-friendly controls and system integration.
First release: Aug 9, 2026
CO3 com.co3Feature riche, open source, AO3 mobile client
First release: Aug 5, 2026
Cobalt com.hanan_bhatti.cobaltUniversal offline-first note capture and personal knowledge archive
First release: Oct 13, 2026
CodeCatcher co.ec.cnsyn.codecatcherFirst release: Jan 27, 2025
- Codec Info com.parseus.codecinfo
First release: Sep 19, 2025
Code Rain one.zagura.CodeRainWallFirst release: Aug 31, 2024
CodeWalk com.verseles.codewalkFirst release: Apr 21, 2026
- Code Word com.peaceray.codeword
First release: Dec 17, 2024
- Coffee com.github.muellerma.coffee
First release: Jul 18, 2025
Coffee com.openappslabs.coffeeFirst release: Jan 2, 2026
Cofi com.omelan.cofiOpen-source coffee timer. Easy-to-use interface. Perfect cup every time!
First release: May 17, 2024
- Coin Collection com.spencerpages
First release: Jul 26, 2026
- Coin Collection com.spencerpages.amazon
First release: Jun 7, 2025
CoinTrend com.cointrendFirst release: Jul 1, 2025
- CoinVert com.rabbittownsoftware.coinvert
First release: Jun 4, 2025
- Colemak Mod-DH Keyboard io.github.colemakmods.mod_dh
First release: Jun 28, 2024
Collective Club Maze com.qwde.ccmFirst release: Oct 8, 2026
Collect the Cookies! nodomain.collectthecookiesFirst release: Oct 8, 2026
ColorBlendr com.drdisagree.colorblendrExpress yourself with colors
First release: Sep 25, 2025
Colorful pl.suve.colorful.androidSimple 2D side-view shooter
First release: Jan 11, 2025
Colorgram com.sidhant.colorgramA free, open-source color logic puzzle game with no ads or tracking
First release: Sep 23, 2026
- Colors Overflow eu.veldsoft.colors.overflow
First release: Jul 31, 2026
Colota com.ColotaSelf-hosted GPS tracker. Open source, geofencing, offline mode, no telemetry
First release: Mar 28, 2026
- Columba com.lxmf.messenger
First release: Mar 13, 2026
Columba network.columba.appFirst release: Sep 25, 2026
- Columba (Kotlin) network.columba.app.kt
First release: Jul 20, 2026
- CoMaps app.comaps.fdroid
First release: Oct 3, 2025
ComfyChair sh.hnet.comfychairFirst release: Jan 20, 2026
CommandClick com.puutaro.commandclick"Linux browser" powered by javascript and ubuntu.
First release: Sep 26, 2025
Commet chat.commet.commetappFirst release: Mar 4, 2026
Commons fr.free.nrw.commonsFirst release: Dec 29, 2025
Compass com.bobek.compassA simple and clean compass
First release: Aug 4, 2025
- Compass Navigator com.draekko.compassnavigator
First release: Oct 11, 2025
- Compass Tile de.klimek.compass
First release: Aug 31, 2025
Compete com.flasskamp.competeFirst release: Sep 29, 2025
- Com-Phone ac.robinson.mediaphone
First release: Jan 19, 2026
Compose Stopwatch com.justdeax.composeStopwatchFirst release: May 23, 2025
- Compound Calculator dev.samyu.compoundcalculator
First release: Oct 8, 2026
Conceal Authenticator com.acktarius.concealauthenticatorSecure 2FA authenticator with blockchain backup and encryption.
First release: Nov 30, 2025
Conceal Mobile com.concealnetwork.concealmobileSecure mobile client for the Conceal Network web wallet.
First release: Oct 9, 2025
- Conceal Mobile com.ConcealNetwork.ConcealMobile
First release: Oct 8, 2025
- Concert Diary io.gitlab.meckez.concertdiary
First release: Jul 31, 2026
Conduit com.gwitko.conduitFirst release: Oct 8, 2026
ConnectBot org.connectbotSimple, powerful, open-source SSH client for Android
First release: Nov 3, 2025
ConnectFour Studio io.github.patrickric.connectfourstudioConnect Four with 15 levels, 20 boards, match mode and perfect analysis
First release: Oct 12, 2026
Connect You com.bnyro.contactsPrivacy focused contacts and SMS messenger app build with MD3
First release: May 4, 2025
- ConsoleFlow space.karrarnazim.ConsoleFlow
First release: Jul 28, 2026
Constanza com.jjrapps.constanzaHabit reminders you answer without opening the app. No cloud, no ads.
First release: Oct 4, 2026
Contacts com.vayunmathur.contactsFirst release: Jan 13, 2026
Contacts org.fossify.contactsManage your contacts privately and efficiently with vCard support
First release: Sep 9, 2025
- Contextium app.xcy7e.contextium
First release: Sep 3, 2026
Control de colonias com.example.controldecoloniasManagement and tracking of ant colonies with NFC and QR.
First release: Nov 22, 2025
Controller for QLC+ com.evanh.qlc_controllerAn Android native 3rd party application for controlling QLC+ v4.
First release: Oct 7, 2026
Conty com.akylas.contyInteractive stories for kids. Download & play offline, anytime!
First release: Oct 4, 2025
Conversations eu.siacs.conversationsEncrypted, easy-to-use XMPP instant messenger for your mobile device
First release: Feb 10, 2026
Converter NOW com.ferrarid.converterproA simple, immediate and fast unit converter!
First release: Aug 24, 2025
- Convertit com.nasahacker.convertit
First release: Sep 4, 2025
- Convertly com.rabbittownsoftware.convertly
First release: May 21, 2025
Cookbook de.lukasneugebauer.nextcloudcookbookView all your recipes stored in your Nextcloud instance.
First release: Aug 13, 2025
- Cookie Extractor com.cookiesextractor.app
Extract your own session cookies after a manual login
First release: Oct 3, 2026
- Coordinate Joker com.github.siggel.coordinatejoker
First release: Nov 8, 2025
Coppelia com.matelsky.coppeliaFirst release: Jul 31, 2026
- Coptic for AnySoftKeyboard com.anysoftkeyboard.languagepack.coptic
First release: Jul 31, 2026
Copy SMS Code io.github.jd1378.otphelperan open-source app that can detect and copy any code for you
First release: Nov 22, 2025
- Core Patch com.coderstory.toolkit
First release: Jun 14, 2025
- Core Patch N org.lsposed.corepatch
First release: Jul 19, 2026
Coreply app.coreply.coreplyappFirst release: Oct 7, 2026
Cosmovisor net.millaguie.cosmovisorSpot satellites overhead in augmented reality
First release: Aug 6, 2026
Couchy Launcher com.conreo.couchytvA fast, private one-screen launcher
First release: Aug 3, 2026
CountAway com.santiagorodriguez.countawayCount days to or from dates with local home-screen widgets
First release: Sep 20, 2026
- Countdate cyou.sk5s.app.countdate
First release: May 1, 2025
- Counter me.tsukanov.counter
First release: Feb 20, 2025
- Count for me com.al.countforme
An interval timer you write, not one you just set.
First release: Oct 3, 2026
- CountryCount de.sipa.countrycount
First release: Jul 31, 2026
- Cove org.bitcoinppl.cove
First release: Jul 16, 2026
Cowspent net.helcel.cowspentFirst release: Aug 3, 2026
CPR Beat dev.alcini.cprbeatOffline CPR metronome: 100–120 bpm, 30:2 mode, rescuer-switch timer
First release: Oct 12, 2026
CPU Info com.kgurgul.cpuinfoCPU Info provides information about device hardware and software.
First release: Jul 3, 2025
CPU Stats jp.takke.cpustatsFirst release: May 25, 2025
Crate com.megamaced.crateFirst release: Sep 9, 2026
- Crazyflie Client se.bitcraze.crazyfliecontrol2
First release: Dec 7, 2023
Critical Maps de.stephanlindauer.criticalmapsFirst release: Feb 8, 2026
- Croatian for AnySoftKeyboard com.anysoftkeyboard.languagepack.croatian
First release: Jul 31, 2026
Croc com.github.howeyc.crocguiFirst release: Nov 25, 2025
croc-app com.dking.crocappModern client for croc, easily and securely send files and text
First release: Aug 22, 2026
crocson com.github.abakum.crocsonFirst release: Oct 8, 2026
- Cromite org.cromite.cromite
First release: Sep 21, 2025
- Crossword org.billthefarmer.crossword
First release: May 17, 2022
CrossWords org.eehouse.android.xw4First release: Oct 8, 2026
Croustillapp fr.croustillappAccess menus, addresses, and contact info for nearly 1,000 CROUS restaurants.
First release: Aug 26, 2026
Cryptocam com.tnibler.cryptocamFirst release: Jul 24, 2025
Crypto ID io.gitlab.cryptographic_idAttest the trustworthiness of a device using asymmetric cryptography
First release: Jul 15, 2025
- Cryptomator org.cryptomator
First release: Oct 6, 2025
Cryptomator org.cryptomator.litePut a lock on your cloud: Take the security of your data into your own hands
First release: Feb 19, 2025
- Cryptool io.github.nfdz.cryptool
First release: Jul 31, 2024
CryptoSafe com.cryptosafe.appOffline AES-256-GCM text encryption with Argon2id, no internet permission
First release: Aug 3, 2026
CryptoTracker jdm.apps.cryptotrackerFirst release: Jun 14, 2025
CryptX com.personx.cryptxSimple Android Cryptography Toolkit
First release: Sep 20, 2025
Crystal Ball de.singular.crystalballDetects guitar chords and combines them into song sheets.
First release: Jul 31, 2026
Crystalpad com.git.itdolan31.crystalpadA simple notepad, no tracking or ads, just your notes
First release: Aug 10, 2026
CSV Editor tech.brianrayburn.csv_editorView and edit CSV files on your Android device
First release: Oct 8, 2026
- Cuberite org.cuberite.android
First release: May 8, 2020
Cube Run cube.runDodge, jump and slam through a neon 3-lane gauntlet. One-thumb 3D runner.
First release: Sep 6, 2026
CubeTimer com.danilolutz.cubetimerOffline 3×3 speedcubing timer with TNoodle scrambles
First release: Sep 29, 2026
Cuppa com.nathanatos.CuppaFirst release: Sep 9, 2025
cups com.cups.appFirst release: Jun 14, 2025
Curbox neth.iecal.curboxApp blocker and screen time tracker. Block apps, websites, reels and shorts.
First release: Aug 7, 2026
- Currencies de.salomax.currencies
First release: Jul 20, 2025
- Currency org.billthefarmer.currency
First release: Jul 31, 2026
Currency Converter net.yukh.currencyCBR & market rates: my currency, favorites, offline cache, daily summary
First release: Aug 10, 2026
- Current Activity io.github.ratul.topactivity
First release: Nov 9, 2025
- cuscon com.froxot.cuscon
First release: Sep 9, 2026
cuscon com.froxot.cuscon.fossThis icon pack adds variety and dynamism to your Home screen
First release: Sep 21, 2025
- Customer Database de.georgsieber.customerdb
First release: Jun 27, 2025
Custom Routes io.github.customroutes.appMark custom climbing routes on gym photos and export shareable images.
First release: Sep 15, 2026
Custom Uploader com.nyx.custom_uploaderFirst release: Jan 23, 2026
Cyclauncher dev.msbs.cyclauncherErgonomic one-handed launcher with side alphabet grid, tags & widgets
First release: Aug 12, 2026
- CycleStreets net.cyclestreets
First release: Jun 21, 2024
Cycluna net.quietflare.cyclunaYour cycle and the moon, tracked privately on your phone.
First release: Oct 3, 2026
CypherLeaf io.gitlab.jrock902.cypherleafPrivate, offline notes with folders, tags, and a lock for sensitive entries.
First release: Sep 3, 2026
- Czech for AnySoftKeyboard org.herrlado.ask.languagepack.czech
First release: Jul 31, 2026
Daak dev.darshit.daakSend files and text between your own devices over Wi-Fi. No account.
First release: Oct 15, 2026
- DAAP org.mult.daap
First release: Aug 27, 2025
- Dagger com.nikola.jakshic.dagger
First release: Aug 31, 2024
Dahdidahdit com.paddlesandbugs.dahdidahditAn Actual Morse Code Trainer — Not Just A Morse Code Generator
First release: Jan 5, 2026
DailyAL io.github.jica98First release: Feb 8, 2026
Daily Diary com.voklen.daily_diaryFirst release: Jun 7, 2025
Daily Dozen org.nutritionfacts.dailydozenFirst release: Oct 28, 2025
- dailylog com.app.dailylog
First release: Feb 4, 2024
- Daily Wallpapers com.gnzalobnites.dailywallpapers
First release: Jul 31, 2026
Daily You com.demizo.daily_youEvery day is worth remembering…
First release: Jan 31, 2026
- Danish for AnySoftKeyboard com.anysoftkeyboard.languagepack.danish
First release: Jul 31, 2026
DankChat com.flxrs.dankchatA simple app to chat on Twitch.tv
First release: Jul 19, 2023
DarkModeLiveWallpaper com.github.cvzi.darkmodewallpaperFirst release: Jun 4, 2025
- DarkShiki org.application.darkshiki
First release: Mar 14, 2026
Dark theme com.phstudio.darkthemeActivate dark theme on your device.
First release: Jul 27, 2024
- Dart Checker com.DartChecker
First release: Dec 18, 2025
DashPay Wallet hashengineering.darkcoin.walletHave your Dash always with you, in your pocket!
First release: Aug 10, 2025
DataBackup com.xayah.databackup.fossFirst release: Oct 8, 2026
- DataBackup com.xayah.databackup.premium
First release: Sep 20, 2025
Databag com.databagFirst release: Nov 8, 2023
Datamosh com.digital.datamoshFirst release: Jul 31, 2026
DataStats jp.takke.datastatsFirst release: May 7, 2025
- Date-a-base com.frabon.rememberthedate
First release: Jul 31, 2026
Datenspuren 2026 info.metadude.android.datenspuren.scheduleFirst release: Sep 2, 2026
DAVY dev.daika.davyLightweight, open-source anime player for Android TV.
First release: Aug 16, 2026
Dawarich (Community) com.sunstep.travel.fossFirst release: Oct 8, 2026
- dawdle godau.fynn.moodledirect
First release: Oct 14, 2025
Daybook com.joebywan.daybookDaily sudoku, nonograms, word and logic puzzles. No ads, no account, offline.
First release: Oct 11, 2026
DayCalcy com.daycalculator.dynamic.appSimple ofline date calculator with reminder.
First release: Oct 13, 2026
- DayExam com.gorden.dayexam
First release: Dec 27, 2025
Dayfile app.zornslemma.dayfileTake notes about your daily life
First release: Oct 24, 2026
DBase Downloader rs.in.dbase.downloaderDownload video and music from 1,750+ sites with yt-dlp and FFmpeg
First release: Sep 16, 2026
DCC++Throttle ru.aleksandr.dccppthrottleApplication to drive DCC-EX command station via Bluetooth
First release: Jul 22, 2025
DDNS Updater xyz.philei.ddnsupdaterFirst release: Sep 12, 2025
De1984 io.github.dorumrr.de1984Privacy-focused Firewall and Package Manager for Android devices
First release: Dec 15, 2025
DeadHash com.codedead.deadhashFirst release: Feb 28, 2025
Debate Timer page.cynosure.timerFirst release: Aug 14, 2026
DebForge com.abhinavxt.debforgeDownload from TorBox, Real-Debrid, AllDebrid, Premiumize and Debrid-Link
First release: Oct 23, 2026
- De-Bloater com.sunilpaulmathew.debloater
First release: Sep 29, 2025
Debug Mode info.yuryv.androiddebugmodeHome screen widget showing USB and wireless ADB debug status at a glance.
First release: Oct 8, 2026
- Debug Quiet com.quietmobile
First release: Feb 4, 2026
- Debug Quiet com.quietmobile.debug
First release: Feb 4, 2026
- DEBUG TRIfA 20260114092749 com.zoffcc.applications.trifa_debug_20260114092749
First release: Mar 17, 2023
- DEBUG TRIfA 20260205150331 com.zoffcc.applications.trifa_debug_20260205150331
First release: Mar 17, 2023
DeBurrow dev.debene.gopherA modern Gopher protocol client for Android.
First release: Aug 4, 2026
Decisioninja io.github.giuig.decisioninjaFirst release: Sep 21, 2026
- Decisions de.markusfisch.android.libra
First release: Aug 13, 2025
DeepLAndroid com.example.deeplviewerFirst release: Aug 3, 2025
Deepr com.yogeshpaliyal.deeprFirst release: Sep 25, 2025
- Deepr Debug com.yogeshpaliyal.deepr.debug
First release: Feb 21, 2026
DeepWave de.binauralbeats.app.fossBinaural beats & isochronic tones for sleep, focus and relaxation
First release: Oct 4, 2026
Defang com.defang.launcherLauncher that puts speed bumps between you and the apps engineered against you
First release: Jul 29, 2026
De Fide com.tristinbaker.defideOffline Catholic app for prayer, Scripture, novenas, and the Rosary.
First release: Aug 3, 2026
DeFlock me.deflock.deflockappFirst release: Jun 30, 2026
- DeJPEG com.je.dejpeg
First release: Aug 21, 2025
Deku SMS com.afkanerd.dekuDekuSMS is an SMS app that supports end to end encryption, cloud forwarding and
First release: May 26, 2025
Deliveries dev.itsvic.parceltrackerTrack all your parcels with ease.
First release: Aug 9, 2025
Delta dev.shadoe.deltaAdvanced hotspot settings for Pixel-like devices
First release: Aug 24, 2025
- Delta website.leifs.delta.foss
First release: Feb 1, 2026
Delta Chat chat.deltaFirst release: Aug 14, 2025
- Delta Chat com.b44t.messenger
Decentralized private messenger with chat-shared tools and games.
First release: Jul 31, 2026
DeltaSync dk.bjoerckbraun.deltasyncEncrypted KeePass sync — requires your own self-hosted server.
First release: Sep 12, 2026
Deluge org.deluge.triremeFirst release: Apr 14, 2024
DEMOCRACY de.democracydeutschland.appFirst release: Nov 8, 2021
Demodulate dev.mateusznowak.demodulateFirst release: Oct 25, 2025
Denaro it.rfmariano.denaroPrivate, offline personal finance with accounts, categories and insights.
First release: Aug 21, 2026
- Derandom org.asnelt.derandom
First release: Dec 1, 2025
Der Die Das com.machiav3lli.derdiedasAndroid app for learning German nouns genders.
First release: Jan 18, 2026
- Deskflow org.tfv.deskflow
First release: Jul 5, 2025
DesKilo de.deskilo.appCoworking community app: desk booking + shared money, libre.
First release: Oct 10, 2026
- DetermApp de.determapp.android
First release: Jul 15, 2024
DetoxDroid com.flx_apps.digitaldetoxGrayscale, doomscrolling breaker, app blocker: a boring phone by default
First release: Sep 10, 2025
- Device Connect net.dcnnt
First release: Feb 28, 2024
Device Watch org.jarsi.devicewatchSystem monitor widget with per-app usage insights and a charging screensaver
First release: Aug 14, 2026
- DevQS me.velc.devqs
First release: Jun 27, 2025
DevSwitch app.devswitchToggle developer options, USB and wireless debugging, with Quick Settings tiles
First release: Sep 22, 2026
Dev Today Stocks com.github.premnirmal.tickerwidget.devFirst release: Nov 8, 2025
- Dhaaga (Dev) io.suvam.dhaaga.dev
First release: Nov 30, 2025
Dhaaga (Lite) io.suvam.dhaaga.liteFirst release: Feb 18, 2025
Dharmik com.shub39.dharmik.onlineFirst release: Jun 4, 2025
DHBW Horb Studenten App de.fampopprol.dhbwhorbFirst release: Sep 18, 2025
Dhizuku com.rosan.dhizukuA tool that can share Device Owner permissions to other applications.
First release: Nov 10, 2025
DhwaniControl io.github.rajnishkmehta.dhwanicontrolRestore system volume controls on devices with broken volume buttons.
First release: Aug 10, 2026
- Diadem ee.malt.diadem
First release: Aug 17, 2026
- Diaguard com.faltenreich.diaguard
First release: Sep 23, 2025
- Dialog Music Player phone.vishnu.dialogmusicplayer
First release: Aug 21, 2025
- Diary org.billthefarmer.diary
First release: Jun 8, 2023
Diary Vault me.sankethbk.dairyappPrivate diary with rich text, cloud backup, sync, and fingerprint lock.
First release: Sep 10, 2025
- Diatronome org.kalinisa.diatronome
First release: Jul 26, 2025
- Dib2Calc com.gitlab.dibdib.dib2calc
First release: Dec 5, 2025
- Dib2Qm net.sourceforge.dibdib.android.dib2qm
First release: Dec 2, 2025
- Dice App codes.swee.diceapp
First release: Mar 18, 2025
- Dice Game org.secuso.privacyfriendlyyahtzeedicer
First release: Jul 4, 2025
- Dicer org.secuso.privacyfriendlydicer
First release: Oct 24, 2025
Dicio org.stypox.dicioVoice assistant: multilanguage, configurable and libre
First release: Oct 9, 2025
Die Simulator com.andreiapps.diesimuA simple app which allows you to roll a die.
First release: Jan 12, 2026
die tageszeitung de.taz.android.app.freeFirst release: Sep 17, 2026
DigiAgriApp org.digiagriappDigiAgriApp is a software aimed at farmers and anyone with cultivated land
First release: Feb 24, 2026
Digilog TV io.github.aldrinzigmundv.digilogtvFirst release: Oct 1, 2024
- DigiPaws nethical.digipaws
First release: May 2, 2025
Digital Calculator com.adeeteya.digital_calculatorA neumorphic themed digital calculator which has keyboard and dark mode support
First release: Apr 28, 2025
- Digital Habits: Focus net.kollnig.greasemilkyway
First release: Sep 11, 2025
- Digits eu.mokrzycki.learndigits
First release: Dec 3, 2024
Diktafon cz.mod42.diktafonFirst release: Jul 26, 2026
Dima Defense org.xolatgames.dima.defenseA simple Tower Defense game that was made in LibGDX
First release: Aug 22, 2026
- DisableAudioFocus io.github.auag0.disableaudiofocus
First release: Mar 24, 2025
- Disable Target API Block de.buttercookie.disabletargetapiblock
First release: Apr 8, 2025
- Discord Timestamp Inserter org.quicksc0p3r.discordtimestamp
First release: Jul 3, 2024
Discover Feed Filter eu.hxreborn.discoveradsfilterHides ads, sponsored cards and clickbait in Google Discover
First release: Aug 28, 2026
- Discreet Launcher com.vincent_falzon.discreetlauncher
First release: Aug 16, 2025
- disky de.felixnuesse.disky
First release: Feb 11, 2026
Dispensa eu.frigo.dispensaManage your pantry and avoid food waste
First release: Dec 22, 2025
Display Toggle io.github.ulysseszh.displaytoggleFirst release: Aug 29, 2025
- Disroot App org.disroot.disrootapp
First release: Aug 26, 2026
DissPair org.disspair.disspairAudit Bluetooth Classic and BLE devices: RFCOMM, GATT and advertisements
First release: Oct 13, 2026
- Distribution Calculator com.nunosempere.distributioncalculator
First release: Jul 20, 2025
DistroHopper be.robinj.distrohopperFirst release: Oct 18, 2025
DJ Edertech com.edertech.dj_edertechThis app invites you to relive the nostalgic curated sets of DJ Edertech.
First release: Jun 2, 2024
- DMS Explorer net.mm2d.dmsexplorer
First release: Nov 3, 2024
- Dnd Toggle net.backslasher.dndtoggle
First release: Dec 5, 2025
- DNS Hero com.gianlu.dnshero
First release: Jun 8, 2023
DNSNet dev.clombardo.dnsnetFirst release: Aug 21, 2025
DNS Resolver com.netshield.dns.psbdxLocal DNS resolver, ad/tracker sinkhole, and traffic monitor
First release: Oct 20, 2026
DNS Toggle com.ericlowry.dnstoggleEasily toggle and automate Private DNS through the Quick Settings panel.
First release: Aug 7, 2026
Doable at.flobii.doableFirst release: Oct 20, 2024
Dobby VPN com.dobby.vpnFirst release: Feb 11, 2026
- DobbyVPN Debug com.dobby.vpn.debug
First release: Oct 4, 2026
Dockeep com.app.dockeepFirst release: Sep 27, 2025
- Documents com.onlyoffice.documents
First release: Aug 12, 2025
Documents org.fossify.documentsRead PDF, DOCX, text, Markdown, CSV and HTML files privately and offline.
First release: Aug 1, 2026
Dog Sports Diary io.github.maocypher.dogsportsdiaryFirst release: Jan 18, 2025
Do It at.co.schwaerzler.maximilian.doitFirst release: Oct 7, 2026
DOI to SciHub com.sigmarelax.doitoscihubFirst release: Oct 8, 2026
- Dokuwiki com.fabienli.dokuwiki
First release: Oct 7, 2025
- DoliDroid com.nltechno.dolidroidpro
First release: Feb 4, 2026
- Dollphone me.x2gd4.dollphone
First release: Sep 18, 2025
Dolphin Emulator org.dolphinemu.dolphinemuFirst release: Jun 11, 2025
- DongChyeonCalendar com.dongchyeon.calendar
First release: Dec 29, 2024
DoNotNotify com.donotnotify.donotnotifyBlock unwanted notifications with customizable rules
First release: Oct 20, 2026
- Doodle xyz.zedler.patrick.doodle
First release: Oct 31, 2024
Doodle Dudette ardash.doodledudetteFirst release: Nov 14, 2024
- Doors of Doom com.github.msx80.doorsofdoom
First release: Dec 12, 2025
Dooz io.github.yamin8000.doozA Tic-Tac-Tao clone, a simple pen-and-paper game
First release: May 26, 2024
Dosezy com.saad2134.dosezyTrack your medications, get timely reminders, and manage your health with ease.
First release: Sep 9, 2026
Do The Thing com.bigdadenergy39.DoTheThingFirst release: Oct 8, 2026
- Dotterel nimble.dotterel
First release: Dec 9, 2024
- Downloader xyz.myachin.downloader
First release: Jul 31, 2026
dpc cz.slaby.dpcFirst release: Jan 26, 2025
Dragon Launcher org.elnix.dragonlauncherLaunch your apps via gesture
First release: Feb 12, 2026
DragTree com.flyboybyte.dragtreeNHRA Pro Tree reaction game — sensor launch, 2 Player, fully offline
First release: Sep 29, 2026
Drausible io.github.cheesymoon.drausibleRead your Plausible Analytics stats, from plausible.io or a self-hosted server
First release: Sep 20, 2026
DrawAnywhere com.shezik.drawanywhereFirst release: Aug 16, 2025
Drawpile net.drawpileA collaborative drawing program
First release: Nov 18, 2025
- drejo player (FOSS) com.drejo.androidvideoplayer.fdroid
First release: Jul 31, 2026
- DresSecureComms com.dresos.dressecurecomms
First release: Jul 30, 2026
Drift io.github.probably_oxy.driftAmbient sound mixer for sleep and focus on long nights and long flights
First release: Sep 15, 2026
Driftly in.hridayan.driftlyA material 3 designed attendance tracker app
First release: Aug 16, 2025
Drill Press Assistant fr.mgth.drillpressSpindle speed calculator and belt position advisor for drill presses
First release: Oct 8, 2026
- Drinkable com.moimob.drinkable
First release: Sep 5, 2025
Drink Water! com.jjrapps.bebeaguaTrack water intake and get timely reminders. No accounts or ads.
First release: Oct 2, 2026
drip com.dripFirst release: Jan 12, 2026
- DriveSoberly com.johanpy.drivesoberly
First release: Jul 31, 2026
- DroidCrypt com.nemesis.droidcrypt
First release: Oct 22, 2024
DroidFish org.petero.droidfishFirst release: Mar 5, 2024
DroidFRPD top.donmor.droidfrpdFirst release: Oct 24, 2025
DroidFS sushi.hardcore.droidfsStore & access your files securely
First release: Sep 15, 2026
Droid-ify com.looker.droidifyFirst release: Jul 6, 2025
- DroidOS Launcher com.katsuyamaki.DroidOSFOSSLauncher
First release: Jul 31, 2026
- DroidOS Pro Trackpad com.katsuyamaki.DroidOSProKeyboardTrackpad
First release: Aug 3, 2026
- DroidOS Trackpad com.katsuyamaki.DroidOSFOSSKeyboardTrackpad
First release: Jul 31, 2026
Droid Pad com.github.umer0586.droidpadBuild control interfaces for WebSocket, Bluetooth/LE, MQTT, TCP & UDP protocols.
First release: Sep 25, 2025
- DroidPlay com.github.warren_bank.airplay_client
First release: Feb 2, 2026
Droidrops com.droidrops.appDroidrops feed reader
First release: Aug 13, 2026
- Droid_SCEP systems.sieber.droid_scep
First release: Dec 3, 2025
- DroidShows nl.asymmetrics.droidshows
First release: Oct 25, 2024
- DroidStress net.tlfoxhuman.droidstress
First release: Jul 31, 2026
- DroidTR IME org.droidtr.keyboard
First release: Jul 31, 2026
DroidVim com.droidvimFirst release: May 6, 2024
droidVNC-NG net.christianbeier.droidvnc_ngVNC server app that does not require root privileges.
First release: Sep 19, 2025
DropCount io.github.jdanders.dropcountA recreation of the classic Drop7 puzzle game for Android
First release: Oct 27, 2026
Drowser com.jarsilio.android.drowserFirst release: Apr 9, 2025
Droynis io.github.capitan0n.droynisRead-only security and privacy audit for your phone
First release: Oct 9, 2026
DSub2000 github.paroj.dsub2000Android client for Subsonic servers.
First release: Feb 8, 2026
- duckAssist org.diekaiju.duckassist
First release: Aug 11, 2026
duckAssist org.duckassist.appLightweight, privacy-focused WebView wrapper for Duck.ai
First release: Sep 16, 2026
- DuckRun de.informationsanarchistik.teapot.megamichi.duckrun
First release: Jul 31, 2026
- DueNot io.github.govin9.duenot
First release: Aug 3, 2026
Duetto com.duettoA tiny Discord for two, on your own server: a permanent voice and video channel.
First release: Sep 9, 2026
DumDum app.dumdumFirst release: Jan 19, 2026
DumpSeeker org.woheller69.dumpseekerDumpSeeker shows sanitary dump stations for camper vans listed in OpenStreetMap
First release: Sep 29, 2025
- Dumpsys Packages Copycat org.rubenpgrady.dpcopycat
First release: Jan 31, 2025
Dungeon Crawl Stone Soup org.develz.crawlFirst release: Feb 8, 2026
- Duorem com.vadimfrolov.duorem
First release: Sep 26, 2026
Duper fr.sudotiz.duperLost your phone? Send it "duper".
First release: Sep 16, 2026
- Duress me.lucky.duress
First release: Jul 20, 2024
- DuressKeyboard duress.keyboard
First release: Jan 9, 2026
- DuressKeyboardLite duress.keyboard.lite
First release: Jul 31, 2026
- DuressUltimate duress.ultimate
First release: Sep 15, 2026
- Dutch for AnySoftKeyboard com.anysoftkeyboard.languagepack.dutch_oss
First release: Jul 31, 2026
DuWave com.polonio.duwaveFirst release: Aug 12, 2026
e1547 net.e1547First release: Jun 7, 2025
- E6B Flight Computer com.jstappdev.e6bflightcomputer
First release: Dec 22, 2025
- Earth View for Muzei com.rafapps.earthviewformuzei
First release: Feb 12, 2024
- Easer ryey.easer
First release: Apr 24, 2022
Easter Eggs com.dede.android_eggsFirst release: Aug 25, 2025
- EasyControlFork com.daitj.easycontrolfork.app
First release: Mar 17, 2025
EasyControlNext com.shiyunjin.easycontrolnext.appFirst release: Oct 17, 2025
Easy Diary me.blog.korn123.easydiaryFirst release: May 13, 2019
- Easy Dice net.pejici.easydice
First release: Jan 6, 2025
Easy Launcher app.easy.launcherEasyLauncher - Minimal and Clutter Free Android launcher
First release: Jul 15, 2025
- Easy Launcher (Nightly) app.easy.launcher.nightly
First release: Feb 11, 2026
- EasyNotes com.r57zone.easynotes
First release: Jul 4, 2025
Easy Notes com.kin.easynotesFirst release: Oct 8, 2026
- Easy Open Link de.audioattack.openlink
First release: Sep 3, 2025
EasySSHFS ru.nsu.bobrofon.easysshfsFirst release: Nov 16, 2025
Easy Sync com.phpbg.easysyncSynchronize your phone with your WebDAV server, the easy way.
First release: Dec 8, 2025
Easy Watermark me.rosuh.easywatermarkSecurely, easily add a watermark to your sensitive photos.
First release: Oct 26, 2025
- Eat Poop You Cat dev.develsinthedetails.eatpoopyoucat
First release: Jul 25, 2024
Ebb com.superdavelab.ebbA period tracker that keeps your cycle on your phone. No account, no internet.
First release: Oct 17, 2026
EbookConverter com.econverter.appAndroid ebook converter — epub, mobi, azw3, docx and more. No Calibre needed.
First release: Aug 3, 2026
EBT New Note com.marv42.ebt.newnoteSubmit Euro bill note data to EuroBillTracker.com
First release: Jun 1, 2025
ECH Apps ie.defo.ech_appsFirst release: Dec 17, 2024
- Echo eu.mrogalski.saidit
First release: Jun 11, 2025
Echo Tiles com.sidhant.echotilesPlay piano tiles to your own music. Open-source, offline, and completely ad-free
First release: Oct 12, 2026
Edge co.edgesecure.appFirst release: Sep 20, 2025
Edge Gallery com.google.ai.edge.galleryFirst release: Sep 18, 2025
Edge Roll edge.rollFirst release: Oct 8, 2026
Edge Seek lsafer.edgeseekControl audio and brightness by sliding on edges
First release: Nov 19, 2025
- Editor org.billthefarmer.editor
First release: Jun 3, 2023
- EDL Dashboard net.xtlive.EDL.Dashboard
First release: Feb 24, 2024
- eduVPN nl.eduvpn.app
First release: Jan 8, 2026
Egg Returns Home com.yepgoryo.EggReturnsHomeFirst release: Oct 8, 2026
- E-Government Liberator it.kapfer.digitalesamt.liberator
First release: Jan 12, 2025
Egyptian Mouse Pounce com.dozingcatsoftware.mouse_pouncePlay Egyptian Rat Screw against humans or cats.
First release: Sep 20, 2026
- Egyptian Writer com.blueapps.egyptianwriter
First release: Aug 24, 2026
- Eidetic io.github.hathibelagal.eidetic
First release: Apr 26, 2025
EigenPlan für Untis eu.laslo_hauschild.your_scheduleYour Untis timetable - colored and readable.
First release: Jan 3, 2026
EinkBro info.plateaukao.einkbroLightweight, fast, and powerful browser designed for E-Ink devices
First release: Jan 9, 2026
- Einschlafhilfe de.msdevs.einschlafhilfe
First release: Jul 13, 2024
Einstein Riddle com.sidhant.einsteinriddleEinstein's Riddle (also known as the Zebra Puzzle)
First release: Aug 14, 2026
Element Classic im.vector.appPrevious generation Element
First release: Aug 6, 2025
Element X io.element.android.xFirst release: Aug 27, 2025
Elite Memo Pro com.deepanjanxyz.notepadWrite, organize, and draw notes with labels, checklists, and reminders.
First release: Sep 3, 2026
ELM327 Emulator com.github.autodiag2.elm327emuOBD-II ELM327 adapter emulator for testing diagnostic apps
First release: Jul 28, 2026
- Elsewhere me.davidteresi.elsewhere
First release: Apr 27, 2021
Emacs org.gnu.emacsFirst release: Aug 1, 2026
- Email com.vayunmathur.email
First release: Jul 31, 2026
- Email org.dystopia.email
First release: Jul 31, 2026
Emborg nl.renzit.emborgOrg-mode viewer and task manager
First release: Aug 21, 2026
- Emerald Dialer ru.henridellal.dialer
First release: Oct 7, 2025
Emotic futuristicgoo.emoticFirst release: Aug 12, 2025
- Enclavd com.enclavd.app
First release: Aug 16, 2026
Encly com.pasich.enclyPrivate notes & tasks with a PIN lock. No account, no internet, no ads.
First release: Sep 29, 2026
Encointerwallet org.encointer.walletInteract with the Encointer Blockchain
First release: Feb 1, 2026
EncryptionApp com.encrypt.bwtText & File Encryption/Decryption with new OverlayTechnology
First release: Feb 7, 2025
- Endless Sky com.github.thewierdnut.endless_mobile
First release: Mar 20, 2023
End of Updates Checker com.trapplab.update_checkerFirst release: Sep 11, 2026
Energize com.flasskamp.energizeTrack your nutrition easily and fast.
First release: Oct 3, 2025
- EnforceDoze com.akylas.enforcedoze
First release: Jan 11, 2026
- Enhanced Music Controller Lite com.mkulesh.onpc
First release: Aug 26, 2025
- Enigma Bridge io.github.legandy.enigmabridge
First release: Aug 3, 2026
EnigmaDroid io.github.deprec8.enigmadroidThe smartest Enigma2 companion for Android.
First release: Sep 13, 2025
Ensemble com.collotsspot.ensembleFirst release: Oct 7, 2026
Ensu io.ente.ensuFirst release: Mar 2, 2026
Ente Auth io.ente.authFree, Cross Platform, Private, Open Source Two Factor Authenticator App
First release: Oct 25, 2026
- Ente Auth io.ente.auth.independent
First release: Aug 20, 2025
Ente Locker io.ente.locker.fdroidFirst release: Oct 8, 2026
Ente Locker io.ente.locker.independentFirst release: Feb 22, 2026
Ente Photos io.ente.photos.fdroidFirst release: Jul 31, 2026
Enthusiast Tea Timer com.sesu8642.infusion_timerFirst release: Dec 19, 2025
Entropy dev.entropyA offline, secure password generator with exact entropy bits measurement.
First release: Aug 16, 2026
- Entropy's Defiance com.hwanderer.entropysdefiance
First release: Sep 1, 2026
eNuts (beta) xyz.elliptica.enuts.betaFirst release: Oct 8, 2026
Envoy com.foundationdevices.envoyFirst release: Aug 14, 2025
- e-Passport Reader com.tananaev.passportreader
First release: Sep 21, 2025
EphemeralWorkProfile ephemeralwp.safespaceProfile owner Android privacy app.
First release: Aug 7, 2026
Épione com.epione.appOffline directory of French health facilities (FINESS open data).
First release: Jul 31, 2026
- Episodes com.redcoracle.episodes
First release: Feb 11, 2025
Episteme com.aryan.reader.ossA document reader for PDF and E-Books
First release: Aug 13, 2026
EP Mobile org.epstudios.epmobileFirst release: Jan 5, 2026
Epoch io.github.RealEarthling.epochTime display for nerds: Unix, sidereal, binary clocks & more.
First release: Aug 8, 2026
Equalizer314 com.bearinmind.equalizer314System-wide EQ with multiband compression, limiter, and audio-visual feedback.
First release: Aug 8, 2026
eQuran com.app.equranRead, listen, choose from 5 reciters, and track your Quran journey.
First release: May 12, 2024
- Ergo Wallet org.ergoplatform.android
First release: Jul 31, 2026
ErmChat io.github.bananguh.ErmChatA feature-packed Twitch chat client for mobile
First release: Oct 4, 2026
Ermis io.github.koukobin.ermis.ermismobileErmis M is an open-source, privacy focused mobile chat application.
First release: Oct 14, 2026
- Esca Agnellis com.k2040.escaagnellis
First release: Aug 16, 2026
Escape Launcher com.geecee.escapelauncherMinimalist home screen with features to help reduce phone distraction
First release: Jan 2, 2026
Escapepod org.y20k.escapepodEscapepod is a simple and lightweight app for listening to podcasts.
First release: Dec 12, 2025
eSpeak com.reecedunn.espeakText-to-speech engine for Android. Based on the eSpeak engine.
First release: Dec 12, 2024
- Esperanto for AnySoftKeyboard com.anysoftkeyboard.languagepack.esperanto
First release: Jul 31, 2026
EstudiaTAI com.tech.estudiataiFirst release: Oct 8, 2026
Étagère fr.framagit.jeromeo.etagereBrowse a Calibre library on your Nextcloud and download EPUBs
First release: Sep 5, 2026
- Etar ws.xsoh.etar
First release: Dec 27, 2025
EtchDroid eu.depau.etchdroidWrite operating system ISO images to USB drives, no root required
First release: Feb 26, 2023
Eternity eu.toldi.infinityforlemmyAn Lemmy client for Android, forked from the Infinity for Reddit project.
First release: Aug 9, 2024
- EteSync com.etesync.syncadapter
First release: Oct 18, 2025
- Ethic Notes org.jpi59.ethicnotes
First release: Sep 25, 2026
Ethic QR Scanner org.jpi59.ethicqrscannerFirst release: Sep 25, 2026
- Etopa de.ltheinrich.etopa
First release: Jul 19, 2025
EUC SoH Analyzer io.github.eucsoh.androidAnalyze electric unicycle battery health from ride logs
First release: Oct 8, 2026
Euria com.infomaniak.euriaEuria, your sovereign AI assistant that respects your privacy and the planet
First release: Jan 6, 2026
EVB Folder Player com.evb.folderplayerOffline audiobooks from your folders, with saved progress and large controls
First release: Oct 9, 2026
evcc io.evcc.androidcharge your EV when the sun is shining or electricity is cheap and clean
First release: Oct 15, 2025
- Eve Game Tracker eve.game.tracker
First release: Aug 12, 2026
Everest io.github.mwageringel.everestFirst release: Feb 4, 2024
Everyday Tasks de.jepfa.personaltaskloggerFirst release: Jan 10, 2026
Every Door info.zverev.ilya.every_doorFirst release: Oct 23, 2025
- Every Door β info.zverev.ilya.every_door.beta
First release: Jan 27, 2026
- Evil Insult Generator com.evilinsult
First release: Aug 25, 2024
- Evil Spin evil.spin
First release: Dec 28, 2024
EVMap net.vonforst.evmapFind electric vehicle charging stations
First release: Sep 21, 2025
eWallet trading.tacticaladvantageFirst release: Oct 18, 2025
- EweSticker com.fredhappyface.ewesticker
First release: Feb 17, 2025
- Ewoc io.github.ewoc2026.ewoc
First release: Jul 31, 2026
eXch. io.github.pitonite.exch_cxAutomatic Cryptocurrency Swaps
First release: Nov 22, 2024
Exclave com.github.dyhkwong.sagernetProxy client
First release: Feb 11, 2026
- Exercise Reminders nodo.crogers.exercisereminders
First release: Sep 16, 2025
Exfilac com.io7m.exfilac.mainFirst release: Dec 17, 2024
- exhale net.retiolus.exhale
First release: Jan 13, 2025
- ExifEdit org.woheller69.exifedit
First release: Aug 21, 2025
- ExifEraser com.none.tom.exiferaser
First release: Sep 21, 2025
Exif Notes com.tommihirvonen.exifnotesquickly save important notes when shooting with film.
First release: Oct 10, 2025
- EXIF Remove si.jakobkreft.exifremove
First release: Sep 3, 2026
Exif Thumbnail Adder com.exifthumbnailadder.appAdd thumbnail in the EXIF tag of JPEG picture not having one (batch processing)
First release: May 20, 2025
ExoAirPlayer com.github.warren_bank.exoplayer_airplay_receiverFirst release: Feb 1, 2026
Exodus org.eu.exodus_privacy.exodusprivacyExodus show you trackers and permissions in apps installed on your device.
First release: Jul 24, 2024
Expandroid com.dingleinc.texttoolsproUltimate toolbox for manipulating text the easy way!
First release: Jul 18, 2025
Expenses de.dbauer.expensetrackerKeep track of your monthly spending
First release: Aug 29, 2025
- Expression Evaluator dudeofx.eval
First release: Jul 31, 2026
Extend io.github.jqssun.displayextendExtend is an all-purpose display manager for any physical or virtual display.
First release: Oct 25, 2026
Extinguish own.moderpach.extinguishHelps you run any android apps as if the screen is on while it is off.
First release: Sep 29, 2024
- Extirpater us.spotco.extirpater
First release: Dec 9, 2024
Ezhuthola com.rr.numio.ezhutholaType Malayalam in Manglish. No ads, no tracking, no internet.
First release: Oct 13, 2026
Fabularium io.davidar.fabulariumFirst release: Jan 13, 2025
FadCam com.fadcamBackground video recorder, screen recorder and remote camera control.
First release: Dec 16, 2025
- FadCam Beta com.fadcam.beta
First release: Jan 26, 2026
FaFa Runner com.chenyifaer.fafarunnerFirst release: Dec 23, 2025
- Fairphone Moments org.thayyil.spring.launcher
Fairphone Moments a minimalist way to use your phone with less distraction.
First release: Sep 27, 2026
FairScan org.fairscan.appFirst release: Feb 25, 2026
FairSpeed org.fairspeed.testA lightweight, privacy-focused network performance monitor.
First release: Sep 17, 2026
- Fairy Mahjong com.fairytrick.fairymahjong
First release: Sep 17, 2026
- FakeBlankScreen net.tlfoxhuman.fakeblankscreen
First release: Jul 31, 2026
- FakeGapps inc.whew.android.fakegapps
First release: Feb 18, 2025
- Fake Traveler cl.coders.faketraveler
First release: Sep 5, 2025
- Fall com.autismprime.fall
First release: Mar 16, 2025
- Fältbok (beta) io.github.mortenfyhn.feltbok.se
First release: Jul 28, 2026
- Family Gem app.familygem
First release: Jun 23, 2025
- Faraday pw.faraday.faraday
First release: Jun 11, 2025
Farhan ly.com.tahaben.farhanFirst release: Jul 6, 2025
- Fast Draw peterfajdiga.fastdraw
First release: Aug 6, 2025
FastLog com.siddharthagolu.fastlogFirst release: Sep 5, 2026
- FastLyrics io.github.teccheck.fastlyrics
First release: Jan 24, 2025
- Fast N Fitness com.easyfitness
First release: Apr 14, 2024
Fast Times com.tmdev.fasttimesSimple, private, open-source intermittent fasting tracker.
First release: Oct 8, 2026
Fast Track com.darkrockstudios.apps.fasttrackFirst release: Aug 25, 2025
Fatto com.brokenpip3.fattoyour Taskwarrior Android companion
First release: Aug 27, 2026
Fauxx com.fauxx.fullPoison data collection profiles by generating decoy signals.
First release: Sep 12, 2026
Faz agora! com.willian.willdoTasks, subtasks and reminders with optional WebDAV synchronization.
First release: Oct 23, 2026
FCast Receiver com.futo.fcast.receiverFirst release: Oct 6, 2025
Fcitx5 org.fcitx.fcitx5.androidFirst release: Nov 1, 2025
Fcitx5 (Anthy Plugin) org.fcitx.fcitx5.android.plugin.anthyFirst release: Oct 8, 2026
Fcitx5 (Chewing Plugin) org.fcitx.fcitx5.android.plugin.chewingFirst release: Oct 8, 2026
- Fcitx5 (Clipboard Filter Plugin) org.fcitx.fcitx5.android.plugin.clipboard_filter
First release: Jul 31, 2026
Fcitx5 (Hangul Plugin) org.fcitx.fcitx5.android.plugin.hangulFirst release: Oct 8, 2026
Fcitx5 (Jyutping Plugin) org.fcitx.fcitx5.android.plugin.jyutpingFirst release: Oct 8, 2026
Fcitx5 (RIME Plugin) org.fcitx.fcitx5.android.plugin.rimeFirst release: Aug 1, 2026
Fcitx5 (Sayura Plugin) org.fcitx.fcitx5.android.plugin.sayuraFirst release: Oct 8, 2026
Fcitx5 (Thai Plugin) org.fcitx.fcitx5.android.plugin.thaiFirst release: Oct 8, 2026
Fcitx5 (Unikey Plugin) org.fcitx.fcitx5.android.plugin.unikeyFirst release: Oct 8, 2026
- Fdbg Hate Rate com.grappim.hateitorrateit.fdroid.debug
First release: Sep 7, 2025
F-Droid Basic org.fdroid.basicThe minimal client app for the app store that respects freedom and privacy
First release: Oct 12, 2026
- F-Droid Build Status de.storchp.fdroidbuildstatus
First release: Jan 25, 2026
FDTracker dev.abhaycloud.fdtrackerFirst release: Jul 26, 2024
Featherline com.mkx.hrttrackerPrivate medication tracker for HRT routines — plans, reminders, personal logs
First release: Oct 15, 2026
Fechtkarte at.j0s.meyercard.appWarm-up drill card generator using notation credited to Joachim Meyer
First release: Aug 31, 2026
- FED debug com.lorenzovainigli.foodexpirationdates.debug
First release: Jun 23, 2025
FediDay 2026 info.metadude.android.fediday.scheduleFirst release: Aug 30, 2026
- Fedilab app.fedilab.android
First release: Jan 19, 2026
Fedilab fr.gouv.etalab.mastodonFirst release: Jul 31, 2026
- FediPhoto-Lineage com.fediphoto.lineage
First release: Aug 26, 2025
- FediPlan app.fedilab.fediplan
First release: Jan 19, 2026
FediSuite org.fedisuite.mobileSchedule, manage and analyze Fediverse accounts on any FediSuite instance
First release: Oct 12, 2026
Feeder com.nononsenseapps.feederFirst release: Feb 8, 2025
- Feeder com.nononsenseapps.feeder.play
First release: Feb 7, 2026
FeedFlow com.prof18.feedflowFirst release: Feb 10, 2026
Feedora com.mohamedaminelouati.feedoraA modern and elegant RSS reader with Material You design
First release: Sep 20, 2026
FeedTV org.juanro.feedtvTV, radio and RSS news. Supports custom M3U lists.
First release: Aug 6, 2025
FeelS com.z3itt.feelsLocal-first feelings wheel for private emotion check-ins.
First release: Sep 21, 2026
Feels App com.feels.feelingsApp.feels_appApp for writing notes and associating them with emotions.
First release: Apr 7, 2024
- FeinstaubWidget de.kaffeemitkoffein.feinstaubwidget
First release: May 11, 2024
Felicity app.simple.felicityAdvance audiophile grade offline music player.
First release: Jul 28, 2026
Feltbok io.github.mortenfyhn.feltbokFirst release: Jul 31, 2026
Fence! com.fencing.scoresPool and tournament management for fencing competitions
First release: Oct 16, 2026
Fennec org.mozilla.fennec_fdroidBrowse the web
First release: Aug 26, 2026
- FetchIt com.tharunbirla.fetchit
First release: Nov 1, 2024
Feudal Tactics de.sesu8642.feudaltacticsFirst release: Sep 9, 2025
- Feurstagram com.instagram.android.feurstagram
First release: Sep 30, 2026
FFShare com.caydey.ffshareCompress image, video and audio files through ffmpeg before sharing them
First release: Dec 7, 2024
- FFUpdater de.marmaro.krt.ffupdater
First release: Jun 15, 2025
- Field Survey net.pufstudio.fieldsurvey
First release: Jul 31, 2026
- FIFA WorldCup 2026 Fixture Widget com.dasp.worldcup2026
First release: Jul 31, 2026
File85Toolkit com.goofwear.file85toolkitLightweight file compression and decompression using LZMA + Base85.
First release: Nov 6, 2025
FileBin de.varakh.fbmobileFirst release: Oct 8, 2026
- FileFlow co.adityarajput.fileflow
First release: Aug 3, 2026
File Manager org.fossify.filemanagerFirst release: Sep 17, 2025
File Navigator com.w2sv.filenavigatorThe missing link between Android and a well-sorted file system
First release: Dec 30, 2025
FilePipe dev.bikram.filepipe.ghFirst release: Jul 28, 2026
- Files com.documentsui.shortcut
First release: Jul 31, 2026
Files com.vayun.filesA powerful file explorer app that can edit many different types of files
First release: Sep 14, 2025
Filester com.roozbehzarei.filesterTemporary cloud storage for fast, private file sharing
First release: Apr 18, 2025
- FillMeUp! com.david.waterreminder
First release: Aug 27, 2026
- FilmFacts com.movietrivia.filmfacts
First release: Feb 16, 2025
FilmFlip org.jumascola.filmflipFilm negative photo recovery app
First release: Aug 21, 2026
Final Benchmark 2 com.ivarna.finalbenchmark2Comprehensive open source CPU benchmark and performance test
First release: Dec 22, 2025
- FinalRozGameNew org.codeberg.rozworld.finalrozgamenew
First release: Jul 31, 2026
Finan+ com.finanplusOffline, encrypted personal finance manager (Brazilian Portuguese)
First release: Oct 13, 2026
- Finance Manager org.secuso.privacyfriendlyfinancemanager
First release: Jul 16, 2025
Find Family cc.findfamily.appFind Family is an end-to-end encrypted location sharing app
First release: Aug 12, 2025
Find Family com.vayunmathur.findfamilyAn end-to-end encrypted location sharing app for family and friends
First release: Jul 31, 2026
- FindMyBus com.jakubhlavacek.gtfsrealtimemap
First release: Dec 18, 2025
Find my IP com.maksimowiczm.findmyipFirst release: Aug 21, 2025
Findroid dev.jdtech.jellyfinThird-party native Jellyfin app
First release: Jan 12, 2026
Find Words com.sidhant.findwordsSolve fun word search puzzles! Connect letters & challenge your brain
First release: Oct 8, 2026
- Finnish for AnySoftKeyboard com.menny.anysoftkeyboard.finnish
First release: Jul 31, 2026
FinTrack com.openapps.fintrackFirst release: Aug 8, 2026
Fintunes nl.moeilijkedingen.jellyfinaudioplayerStreaming audio player for Jellyfin
First release: Aug 4, 2025
- Fire2Kodi com.isayso.fire2kodi
First release: Sep 20, 2025
Firefly III Shortcuts com.mustafacanyucel.fireflyiiishortcutsFirst release: Mar 26, 2025
Firefly Nightly social.firefly.nightlyFirst release: Jan 1, 2026
FireflyNotes org.swlabs.fireflynotesSimple notes app that deletes notes after 24 hours
First release: Oct 8, 2026
Firefox Klar org.mozilla.klarFirst release: Apr 29, 2024
- Firefox No Home Button moe.henry_zhr.firefox_no_home_button
First release: Aug 3, 2024
- FireWall Blocks com.shayan.firewall
First release: Dec 16, 2025
FirTube fir.tubeFirst release: Sep 15, 2026
- Fish Rings for Android eu.veldsoft.fish.rings
First release: Sep 16, 2025
FiSSH dev.ioanm.fisshFirst release: Oct 8, 2026
FitBook com.presley.fit_bookFirst release: Sep 25, 2025
FitBuddy com.anant.fitbuddyAI calorie & workout tracker with region-aware diets — log by photo or text
First release: Jul 31, 2026
fitforge com.fitforge.fitforgeOffline fitness & nutrition tracker with optional AI coaching
First release: Oct 8, 2026
- Fitness Calendar com.inky.fitnesscalendar
First release: Jul 23, 2025
- Fit Notifications com.abhijitvalluri.android.fitnotifications
First release: Feb 24, 2024
FitoTrack de.tadris.fitnessFirst release: Jul 29, 2024
- Five Prayers com.hbouzidi.fiveprayers
First release: Nov 29, 2023
FixupXer - URL Enhancer com.fixupxerFirst release: Jul 23, 2025
Flabr ru.iska9der.flabrclient for habr.com
First release: Jun 27, 2025
Flac-R com.resurrect.flac_rPerfect your collection.
First release: Aug 6, 2026
Flang de.tadris.flangFirst release: Dec 31, 2025
Flare dev.dimension.flareBrowse Mastodon, Bluesky, X, Misskey, Nostr and RSS all in one app.
First release: Dec 21, 2025
- FLARE org.flare.app
First release: Jul 31, 2026
Flare Enough club.hiraeth.flareenoughCalm, private, offline tracking for medication, symptoms and stillness.
First release: Oct 4, 2026
- FlashAlert fr.jnda.android.flashalert
First release: Aug 3, 2024
Flashbyte com.flashbyteA fast cross-platform file sharing app.
First release: Sep 5, 2026
- FlashCards com.quchen.flashcard
First release: Mar 12, 2024
Flash Deck m.co.rh.id.a_flash_deckA simple and easy to use flash card to help you study
First release: Feb 1, 2026
- FlashDim com.cyb3rko.flashdim
First release: Sep 6, 2025
Flashy rocks.poopjournal.flashySimple and Privacy-Friendly Flashlight App
First release: Feb 9, 2026
Flauth net.liujiacai.flauthFirst release: Jan 16, 2026
FlClash com.follow.clashFirst release: Jul 29, 2025
Flex com.presley.flexifyFirst release: Sep 24, 2025
FlickBoard se.nullable.flickboardThe Predictable Keyboard
First release: Jan 7, 2026
Flicky app.flickyUnofficial Fdroid client (for Android TV)
First release: Sep 24, 2025
Flicky Bee org.lettucepie.flickybeeFlick and Bumble your way through the flowers.
First release: May 22, 2024
Flip 2 DND dev.robin.flip_2_dndFirst release: Aug 18, 2025
- Flip a coin org.ecos.logic.flip_a_coin
First release: Oct 13, 2024
Flipper com.flipperdevices.appFirst release: Jul 2, 2025
Flixclusive com.flixclusiveFirst release: Oct 1, 2024
FloatDeck app.floatdeck3D parallax live wallpaper with gyroscope sensor support
First release: Aug 28, 2026
- Floating Mute com.github.mkalmousli.floating_mute
First release: May 20, 2025
Floating Timer xyz.tberghuis.floatingtimerFeatures both a countdown timer and stopwatch that will float over other apps.
First release: Feb 5, 2026
Floating Volume com.github.mkalmousli.floating_volumeFirst release: Oct 11, 2025
floccus bookmark sync org.handmadeideas.floccusFirst release: Aug 27, 2025
- FloFla Cards com.floflacards.app
First release: Jul 31, 2026
Florae cat.naval.floraeFirst release: Jun 24, 2025
Florid com.nahnah.floridF-Droid Client, but on UX steriods
First release: Feb 10, 2026
FlorisBoard dev.patrickgold.florisboardFirst release: Sep 9, 2025
- FlorisBoard Beta dev.patrickgold.florisboard.beta
First release: Nov 28, 2025
Flow io.github.aedev.flowFirst release: Jul 18, 2026
Flow mn.flow.flowFirst release: Feb 8, 2026
Flowit! com.bytehamster.flowitgameFill all boxes with the color of their border
First release: Jul 15, 2025
- Flow Nightly dev.linwood.flow.nightly
First release: Jan 9, 2026
Fluffy app.fluffyFirst release: Sep 22, 2025
FluffyChat chat.fluffy.fluffychatThe open-source, non-profit European alternative to big tech’s messaging and vid
First release: Jun 19, 2023
- FlutCrack com.example.flut_crack
First release: Sep 2, 2024
Flut Renamer net.sunjiao.renamerFirst release: Jan 6, 2025
Flutter McSweepy de.justquitstudios.fluttermcsweepyFirst release: Oct 8, 2026
Flux com.fluxStay organized. Stay focused. Stay in Flux.
First release: Aug 10, 2025
Flux com.mskd.fluxModern local video player and library for your movies, TV shows, and anime.
First release: Jul 31, 2026
FluxLinux com.ivarna.fluxlinuxRun full Linux desktop environments on Android with GPU acceleration
First release: Aug 17, 2026
Flux News de.circle_dev.flux_newsFirst release: Feb 5, 2026
- FluxTube com.fazilvk.fluxtube
First release: Jan 20, 2026
Flybook com.luchowl.flybookPrivate offline flight logbook for aviation enthusiasts
First release: Sep 11, 2026
- Flying Carpet dev.spiegl.flyingcarpet
First release: Mar 27, 2025
- FMD de.nulide.findmydevice
First release: Nov 23, 2025
FMD edge de.nulide.findmydevice.edgeLocate and control your device remotely
First release: Aug 16, 2026
- FoCal ch.mydoli.focal
First release: Jan 22, 2024
Focus com.focus.launcherA text-only, black and white launcher with app timers and a weekly review
First release: Sep 22, 2026
FocusBuddy com.focusbuddy.appFirst release: Oct 8, 2026
Focus for Mastodon allen.town.focus.mastodonFocusMastodon is a bright and colourful Mastodon client
First release: Jan 19, 2026
- Focus Launcher dev.mslalith.focuslauncher
First release: Mar 2, 2024
FocusPodcast allen.town.focus.podcastFocusPodcast is a quality podcast management and playback application
First release: Jan 19, 2026
Foggy Maps ca.asmat.foggymapsA personal exploration map where fog dissipates where you have walked.
First release: Sep 3, 2026
- Föhnix foehnix.widget
First release: Oct 9, 2024
Fokus io.github.luantak.fokuslauncherMinimal launcher with clock, weather, fast app search, and gesture navigation.
First release: Aug 11, 2026
- folder launcher me.robbyblue.mylauncher
First release: Jan 3, 2026
Foldio fr.kanis.foldioA music player that treats folders as playlists.
First release: Aug 16, 2026
- Fold Switcher com.eiyooooo.foldswitcher
First release: Apr 11, 2025
Folio com.folio.readerFirst release: Aug 7, 2026
- Fomodoro com.arijit.pomodoro
First release: Jul 30, 2025
Font Gallery com.adeeteya.font_galleryAn App to display how different fonts families and their variations look.
First release: May 4, 2025
- Fonts com.je.fontsmanager.samsung
First release: Dec 13, 2025
- FontStylr com.fontstylr
First release: Jul 31, 2026
- Food-E app.suhasdissa.foode
First release: Aug 2, 2023
- Food Expirations com.lorenzovainigli.foodexpirationdates.foss
First release: Nov 2, 2025
- Food Tracker org.secuso.privacyfriendlyfoodtracker
First release: Jul 16, 2025
Food You com.maksimowiczm.foodyouFirst release: Sep 21, 2025
Force Stop Helper com.raiiware.forcestophelperHelps you manually force-stop background apps.
First release: Dec 12, 2025
- Forecastie cz.martykan.forecastie
First release: Dec 8, 2025
- ForgetMeNot git.gay.gloocannon.forgetmenot
First release: Aug 4, 2026
Fork Client org.forkclient.messenger.betaFirst release: Jan 24, 2026
- Fork Client org.forkgram.messenger
Forkgram is a fork of the official Telegram for Android application.
First release: Oct 16, 2026
- Forkgram Classic org.forkgram.classic
A Telegram fork preserving the classic UI from before the Liquid Glass era.
First release: Jul 31, 2026
Forkyz app.crossword.yourealwaysbe.forkyzCrossword puzzles application, download and play.
First release: Sep 18, 2025
- Forkyz app.crossword.yourealwaysbe.forkyz.release
First release: Nov 7, 2025
Forkyz Scanner app.crossword.yourealwaysbe.forkyzscannerFirst release: Jan 19, 2026
Formulus org.opendataensemble.formulusOffline-first bespoke data collection apps from Open Data Ensemble
First release: Aug 21, 2026
- ForPDA org.softeg.slartus.forpdaplus
First release: Apr 10, 2024
- forte hunterirving.forte
First release: Oct 20, 2020
- Fortuna ir.mahdiparastesh.fortuna.gregorian
First release: Apr 23, 2025
FortuneTelling com.zengtao.fortunetellingOffline Western astrology, I Ching divination, and Chinese daily almanac
First release: Aug 26, 2026
FOSDEM 2026 Schedule info.metadude.android.fosdem.scheduleFirst release: Oct 8, 2026
- FOSDEM Companion be.digitalia.fosdem
First release: Jan 17, 2026
FOSS4G 2024 Schedule app.smarzaro.foss4g2024.scheduleFirst release: Nov 12, 2024
FOSS4G Europe 2025 info.metadude.android.foss4g.scheduleFirst release: Oct 8, 2026
- FOSS Browser de.baumann.browser
First release: Dec 15, 2025
FOSSGIS 2026 Schedule info.metadude.android.fossgis.scheduleFirst release: Oct 8, 2026
FOSS Warn de.nucleus.foss_warnReceive emergency alerts worldwide
First release: Dec 5, 2025
Fossy Protokoll de.pascalstier.fossyprotokollDocument rental defects and build protocols — offline, no tracking.
First release: Sep 27, 2026
Foto Timer com.exner.tools.fototimerApp that counts, beeps, and helps with repeating tasks, such as at the gym.
First release: May 3, 2025
FoxAppMemo com.rtneg.foxappmemoFirst release: Oct 8, 2026
- Fox RSS com.pigeoff.rss
First release: Aug 2, 2022
FPInk com.fpink.captureCapture handwritten fountain-pen notes, recognized offline by default
First release: Oct 15, 2026
FPS Meter com.rdevzph.fpsmeterLightweight real-time FPS overlay and game performance monitor
First release: Oct 12, 2026
FrameExtractor com.tailgunnerx.frameextractorExtract high-resolution frames from any video with millisecond precision.
First release: Oct 8, 2026
Fread com.zhangke.freadFirst release: Sep 5, 2025
- Freebloks de.saschahlusiak.freebloks
First release: Sep 5, 2025
- FREE Browser org.woheller69.browser
First release: Sep 20, 2025
- FreeCell4 org.lufebe16.freecell
First release: Mar 23, 2025
freeCodeCamp org.freecodecampFirst release: Aug 13, 2025
freeDictionary io.github.yamin8000.owlFirst release: Oct 28, 2025
- FreedomBox org.freedombox.freedombox
First release: Jul 31, 2026
Freedom Guard com.freedom.guardFirst release: Sep 5, 2025
Freedoom net.nullsum.freedoomFirst release: May 14, 2024
FreeFTP com.freeftp.appFree FTP, FTPS and SFTP client. No ads, no paid tier, no tracking.
First release: Sep 20, 2026
- Free Klondike eu.veldsoft.free.klondike
First release: Jul 31, 2026
- Freeminer org.freeminer.freeminer
First release: Mar 5, 2025
- Free Notifications de.binarynoise.freeNotifications
First release: Jul 31, 2026
- FreeOTP org.fedorahosted.freeotp
First release: Feb 6, 2025
- FreeOTP+ org.liberty.android.freeotpplus
First release: Feb 11, 2024
FreePaint io.github.pastthepixels.freepaintA vector graphics drawing app for Android.
First release: May 10, 2024
FreeProxy tech.xvanturing.freeproxyRoute your traffic through a SOCKS5 or HTTP proxy, per app.
First release: Aug 13, 2026
Freerse com.apps.freerseFirst release: Jul 9, 2024
- Free the bugs com.game.freethebugs
First release: Aug 5, 2025
- FreeTube io.freetubeapp.freetube
First release: Aug 23, 2025
- Free TV com.phstudio.freetv
First release: Aug 10, 2024
- FreeView com.rouf.freeview
First release: Aug 16, 2026
- Freies Radio de.radiozeit.freiesradio.fdroid
First release: Jul 31, 2026
- French for AnySoftKeyboard com.anysoftkeyboard.languagepack.french
First release: Jul 31, 2026
Freqcast com.freqcastInternet radio player that finds streams by pasting a station's website
First release: Oct 18, 2026
- Frequent Habits com.frequent.habits
First release: Aug 2, 2026
- Fridgey lying.fengfeng.foodrecords
First release: Oct 19, 2025
frigoligo net.casimirlab.frigoligoYour articles with you
First release: Mar 14, 2025
Frogue io.github.necrashter.natural_revengeFirst release: Jul 28, 2025
FrOSCon 2026 Schedule info.metadude.android.froscon.scheduleFirst release: Aug 1, 2026
Frosty com.tommychow.frostyFirst release: Oct 8, 2026
- Fruity Game page.codeberg.marshreaper.fruitygame
First release: Nov 20, 2023
FTPClient de.qwerty287.ftpclientA simple FTP, FTPS and SFTP client for Android
First release: Jul 11, 2025
- FTP Server (Free) be.ppareit.swiftp_free
Access your phone wirelessly
First release: Aug 21, 2026
FTPS Server com.siarheikuchuk.ftpsserverRun a secure FTP server and share files on your local network, with no ads.
First release: Sep 21, 2026
Fucks Given rocks.poopjournal.fucksgivenSelf-love is the greatest middle finger of all time.
First release: Feb 9, 2026
- Fudge dev.danielc.fujiapp
First release: Aug 7, 2025
fujiten fr.odrevet.fujitenJapanese dictionary made with Flutter
First release: Oct 26, 2025
Fulguris net.slions.fulguris.full.fdroidFast, customizable with sessions, ad blocking & privacy features
First release: Feb 8, 2026
- Funktrainer de.hosenhasser.funktrainer
First release: Jul 24, 2025
furtive com.ethicnology.furtiveFirst release: Oct 26, 2026
- FutharkBoard de.drmaxnix.futharkboard
First release: Jul 31, 2026
FUTO Keyboard org.futo.inputmethod.latinFirst release: Jul 21, 2025
Futon io.github.landwarderer.futonManga reader with online catalogues ( kotatsu fork )
First release: Jan 2, 2026
- Futon Nightly io.github.landwarderer.futon.nightly
First release: Jan 31, 2026
- Futoshiki com.hexcorp.futoshiki
First release: Aug 5, 2026
FUTO Voice Input org.futo.voiceinputFirst release: Feb 12, 2026
- fWallet business.braid.f_wallet
First release: Jul 17, 2024
FW-Wettkampf Funk-Trainer de.questmaster.wettkampf_funk_trainerFirst release: Jan 12, 2026
G1nkgo org.comunes.g1nkgoĞ1 Wallet: simple, quick, modern and versatile
First release: Oct 1, 2026
g8 com.a4a.g8invoicingInvoice in 10 seconds & bundle quotes and delivery notes into invoices!
First release: Jan 8, 2026
Gaai be.cuypers_ghys.gaaiFirst release: Dec 29, 2025
Gadgetbridge nodomain.freeyourgadget.gadgetbridgeUse your smart watch and other bluetooth devices and keep your data private!
First release: Oct 9, 2026
Gallery com.aks_labs.tulsiAI-powered photo gallery with offline OCR text search and elegant design
First release: Jul 9, 2025
Gallery com.pixel.gallerySleek, privacy-focused gallery with Material You and Motion Photo support.
First release: Feb 8, 2026
- Gallery com.zs.android.apps.photos
First release: Aug 5, 2026
Gallery org.fossify.galleryFirst release: Sep 8, 2025
- GAMA com.popovicialinc.gama
First release: Sep 22, 2026
Game Counter net.multun.gamecounter.fdroidA customizable game point counter
First release: Oct 2, 2025
- GameMaster Dice de.duenndns.gmdice
First release: Jan 16, 2026
GameNative app.gamenativeFirst release: Mar 15, 2026
Game Trader io.gitlab.selosh.gametraderNotifications for SteamTrades.com
First release: Mar 13, 2024
Garage com.fearmikey.garageA modern, privacy-focused, comprehensive vehicle management app.
First release: Oct 3, 2026
garlic-player com.sagiadinos.garlic.playerDigital Signage Media Player based on SMIL standard
First release: Jul 18, 2025
- Gas Prices org.woheller69.spritpreise
First release: Nov 11, 2025
Gauguin org.piepmeyer.gauguinFirst release: Aug 31, 2025
gc dev.scarf.gcGitHub Contribution graph widget
First release: Oct 5, 2026
- Gcam Services Provider com.google.android.apps.photos
First release: Jul 31, 2026
- Gcam Services Provider de.lukaspieper.gcam.services
First release: Jul 5, 2025
gCompat-UP org.unifiedpush.distributor.fcmUnifiedPush provider using Google Services
First release: Feb 11, 2026
GCompris net.gcompris.fullFirst release: Sep 29, 2026
GDF HEMA Timer com.gdf.hema_timerA precise and minimal timer for HEMA training and sparring.
First release: Nov 9, 2025
- G-Droid org.gdroid.gdroid
First release: Apr 17, 2025
- GeauxWeather com.geauxweather.app
First release: Aug 11, 2026
Gecko com.anant.geckoTime-travelling audio recorder — save what just happened
First release: Oct 12, 2026
Geekttrss com.geekorum.ttrss.freeFirst release: Sep 16, 2025
Gem com.gemwallet.androidSecure crypto wallet for 100+ blockchains: Bitcoin, USDT, ETH, Solana, and more.
First release: Jul 31, 2026
- geminiAssist io.github.acidefluorhydrique.geminiassist
First release: Jul 31, 2026
Gendie com.languageapp.gendieFirst release: Oct 8, 2026
- Gentle Glow: Onyx BOOX com.onyx.darie.calin.gentleglowonyxboox
First release: Jan 5, 2025
- GeoGas com.eliasbuenosdias.geogas
First release: Jan 9, 2026
- Geohash Droid net.exclaimindustries.geohashdroid
First release: Oct 3, 2026
- GeoJoystick com.k2040.geojoystick
First release: Aug 17, 2026
- Geological Timescale org.tengel.timescale
First release: Feb 23, 2025
GeoNotes de.hauke_stieler.geonotesFirst release: Nov 23, 2024
- Georgian for AnySoftKeyboard com.anysoftkeyboard.languagepack.georgian
First release: Jul 31, 2026
Geotag video camera org.app.geotagvideocameraCamera with a map and coordinates overlay.
First release: Aug 17, 2025
GeoWeather com.freetime.geoweatherModern weather app with 16-day forecast for multiple cities
First release: Feb 11, 2026
- GeoWeather io.github.freetimemaker.geoweather
First release: Apr 26, 2026
Gerberoid se.pp.mc.android.GerberoidFirst release: Jan 22, 2024
- German for AnySoftKeyboard com.anysoftkeyboard.languagepack.german
First release: Jul 31, 2026
- GestureFlow com.tharunbirla.gestureflow
First release: Dec 14, 2025
- geteduroam app.eduroam.geteduroam
Configure eduroam by using your institution profile
First release: Jan 19, 2026
getgovroam app.govroam.getgovroamFirst release: Aug 5, 2026
Geto com.android.getoApply device settings to your apps.
First release: Oct 12, 2025
Gfrör.li ch.coredump.watertemp.zhFirst release: Jan 11, 2026
Ghest dev.margani.ghestTrack loans and fixed payments: where you are and when they end, fully offline
First release: Oct 14, 2026
- Ghost Commander com.ghostsq.commander
First release: Jul 31, 2026
- Ghost Rain org.ghostrain
First release: Jul 31, 2026
Ghost Search org.darknetcrawler.mobileTor onion search aggregator. Privacy-first, RAM-only, no tracking.
First release: Oct 20, 2026
Gibsonify org.gibsonify.gibsonifyFirst release: Feb 21, 2023
GifBoard com.gifboardFirst release: Oct 8, 2026
Giggity net.gaast.giggitySchedule viewer for conferences and other events
First release: Dec 8, 2025
Gitalchemy com.thomas.pedot.gitlalchemyFree and open source GitLab client for Android
First release: Sep 15, 2026
GitaVani com.nikhilsi.gitavaniAd-free Bhagavad Gita reader with Sanskrit audio, translations & commentaries
First release: Oct 8, 2026
- Git+ Coach com.vishal2376.gitcoach
First release: Dec 24, 2024
Gitlalchemy com.thomas.pedot.expogitlabclientFirst release: Mar 11, 2025
Gitling com.maneeshacooray.gitlingGit client built with Jetpack Compose and Material 3 Expressive
First release: Jul 30, 2026
GitNex org.mian.gitnexNative client for Forgejo and Gitea
First release: Jan 17, 2026
GitNote io.github.wiiznokes.gitnoteTake note, using a git backend
First release: Sep 25, 2025
- GitNote-Nightly io.github.wiiznokes.gitnote.nightly
First release: Jan 14, 2026
GitSync com.viscouspot.gitsyncGit client for syncing a repository between remote and a local directory
First release: Sep 20, 2025
Gizz Tapes gizz.tapes.fossStream King Gizzard and the Lizard Wizard shows right to your phone!
First release: Oct 31, 2026
- Gizz Tapes gizz.tapes.full
First release: Aug 24, 2025
- GLMark2 org.linaro.glmark2
First release: Jul 11, 2025
Global Icon Pack com.richardluo.globalIconPackFirst release: Sep 7, 2025
Globalsend com.peer.topeer.global_sendFirst release: Aug 7, 2026
gloomy io.github.mority.gloomyA dim, night-vision-friendly screen light with swipe controls
First release: Oct 28, 2026
Glosdalen com.glosdalen.appVocabulary lookup with direct Anki card creation
First release: Dec 30, 2025
- GLPI Agent org.glpi.inventory.agent
First release: Aug 10, 2026
- GlucoDataHandler de.michelinside.glucodatahandler
First release: Sep 18, 2025
- Gluco Glance com.mohasi.glucoglance
First release: Sep 20, 2026
Glyfen dev.glyfen.appFirst release: Oct 8, 2026
GlyphPort com.sebiai.glyphportPort Nothing® Glyph Compositions between phones
First release: Oct 8, 2026
- GMaps WV us.spotco.maps
First release: Nov 10, 2025
- Godot Dice Roller net.canvoki.godot_dice_roller
First release: Jul 10, 2025
- Godot Editor 3 org.godotengine.editor.v3
First release: Jul 31, 2026
- Godot Engine 4 org.godotengine.editor.v4
First release: Jul 31, 2026
Goguma fr.emersion.gogumaFirst release: Jan 7, 2026
- Golden Ratio lv.RIN4X.goldenratio
First release: Apr 12, 2025
Golden Ticket org.golden_ticket.golden_ticketLottery simulation game - explore strategies without spending money
First release: Oct 8, 2026
- Golem.de de.eknoes.inofficialgolem
First release: Jun 21, 2024
- GoL Screensaver me.haroldmartin.golwallpaper
First release: May 20, 2025
- good-echo com.goodecho.app
First release: Jul 31, 2026
Goodtime com.apps.adrcotfas.goodtimeMinimalist focus timer for deep work & study | pomodoro & time tracking
First release: Nov 25, 2025
Goregram com.amanoteam.flonneA Telegram fork with minimal extra features
First release: Aug 3, 2026
Gosling xyz.block.goslingFirst release: Apr 17, 2025
- Gotify com.github.gotify
First release: Sep 29, 2025
Gotweb org.gameoftrees.gotweb_authenticatorGame of Trees Web Authenticator App
First release: Oct 16, 2026
GPA Calculator com.gpa.calculator.gpa_calculatorGPA & CGPA calculator with support for AUIS grading rules
First release: Aug 25, 2025
GPA Whiz com.deehem.gpawhizOffline academic tracker: GPA, CGPA, timetable, and scholarship deadlines
First release: Sep 16, 2026
- GPG Key Manager com.gpgapp
First release: Sep 27, 2026
GPN 2026 Schedule info.metadude.android.gpn.scheduleFirst release: Oct 8, 2026
GPSCarTracking com.domivega.gps_carGPS tracks with live OBD-II metrics; offline queue to your own server
First release: Oct 12, 2026
- GPS Cockpit org.woheller69.gpscockpit
First release: Sep 8, 2025
- gpsdRelay io.github.project_kaat.gpsdrelay
First release: Sep 8, 2025
- GPS Locker com.github.mrrar.gps_lock
First release: Apr 15, 2024
- GPS Locker com.github.mrrar.gps_locker
First release: Apr 17, 2024
GPSLogger com.mendhak.gpsloggerA lightweight GPS logger, battery efficient, GPX/KML, add notes, share, upload.
First release: Jun 23, 2025
- GPS Logger eu.basicairdata.graziano.gpslogger
First release: Dec 1, 2024
- GPS Setter io.github.jqssun.gpssetter
First release: Mar 5, 2025
- gptAssist org.woheller69.gptassist
First release: Oct 10, 2025
- GPT Box tech.lolli.flutter_gpt
First release: Feb 26, 2025
GPTMobile dev.chungjungsoo.gptmobileFirst release: Jan 6, 2025
- GPXIT dev.gpxit.app
First release: Aug 15, 2026
GPX Mock Location su.mya.mocklockA reliable mock location provider that actually works to replay GPX tracks.
First release: Oct 4, 2026
- Grabagram uk.co.busydoingnothing.anagrams
First release: Apr 12, 2024
Grace Launcher com.galaxyrio.gracelauncherA simple launcher with an app list, calendar agenda and music controls
First release: Oct 3, 2026
Graded com.NightDreamGames.Grade.lyTrack and manage your school grades with ease
First release: May 24, 2025
Gramophone org.akanework.gramophoneSimple offline music player with minimalistic design
First release: May 20, 2025
Graph 89 com.Bisha.TI89EmuDonationA TI Graphing Calculator Emulator
First release: Apr 26, 2024
- Graph 89 com.eanema.graph89
First release: Oct 7, 2026
GraphHopper Maps com.graphhopper.mapsOnline route planner and experimental GPS navigation
First release: Jan 27, 2026
Gravel com.anopticlabs.gravelA de-googled, hardened fork of the Pebble companion app for de-googled phones
First release: Aug 26, 2026
Grayjay com.futo.platformplayerFirst release: Sep 26, 2025
Graysky dev.mozzius.grayskyFirst release: Feb 10, 2025
Grazer Linuxtage Schedule at.linuxtage.EventfahrplanSchedule of the Grazer Linuxtage (GLT)
First release: Apr 25, 2025
- Greek for AnySoftKeyboard com.anysoftkeyboard.languagepack.greek
First release: Jul 31, 2026
- Greek Reference com.benlinskey.greekreference
First release: Nov 5, 2025
GreenStash com.starry.greenstashPlan, manage, and achieve your savings goals easily
First release: Sep 12, 2025
- Gridle org.billthefarmer.gridle
First release: Jan 15, 2026
Gridlink app.gridlinkA fast, private JMAP and IMAP email client. No ads, no tracking, no Google.
First release: Sep 20, 2026
Grit com.shub39.gritSimple to-do list & habit tracker with streaks, analytics and widgets
First release: Feb 10, 2026
- Groce com.groce.app
First release: Aug 2, 2026
Grocery Genius com.rendox.grocerygeniusFirst release: Sep 13, 2024
- Grocy xyz.zedler.patrick.grocy
First release: Jan 2, 2026
Groestlcoin Wallet hashengineering.groestlcoin.walletFirst release: Oct 8, 2026
- Groestlcoin Wallet TestNet hashengineering.groestlcoin.wallet_test
First release: May 1, 2025
Grove com.resurrect.groveVisualize your growth.
First release: Sep 27, 2026
- GSM Location Service org.fitchfamily.android.gsmlocation
First release: May 22, 2024
- GSYGithubAppFlutter com.shuyu.gsygithub.gsygithubappflutter
First release: Dec 22, 2025
gttrpg com.feko.generictabletoprpgQuick access for your DnD data and tracking your character data and encounters.
First release: Nov 16, 2025
- GuessIron de.indie42.guessiron
First release: Jul 15, 2024
GuessThatPokemon com.nima.guessthatpokemonA game where you guess pokemon names and you capture them.
First release: Apr 28, 2025
- Gugal com.porg.gugal
First release: Sep 25, 2025
Guileless Bopomofo org.ghostsinthelab.apps.guilelessbopomofoA simple Bopomofo software keyboard (input method editor) for typing Hanyu
First release: Jan 10, 2026
- Gurgle org.billthefarmer.gurgle
First release: Feb 1, 2026
Gyawun Music com.jhelum.gyawunStream music from YouTube Music
First release: Jan 23, 2026
Gym Bott com.exner.tools.gymbottFirst release: Jul 31, 2026
GymLog io.github.dcmcand.gymlogSimple offline workout tracker. No accounts, no cloud, no tracking
First release: Oct 3, 2026
- GymLoga com.mbosse.gymloga
First release: Jul 31, 2026
- GymMane com.gymmane.app
First release: Sep 9, 2026
- GymRoutines com.noahjutz.gymroutines
First release: Feb 20, 2022
- GymWen com.asdoi.gymwen
First release: Jun 21, 2024
- H2Byte org.thebytearray.h2byte
First release: May 15, 2025
Habit Builder com.ofalvai.habittrackerFirst release: Nov 11, 2024
Habitica com.habitrpg.android.habiticaTreat your life like a game to stay motivated and organized!
First release: Jun 21, 2024
Habit-Maker com.dessalines.habitmakerFirst release: Sep 15, 2025
Habits org.isoron.uhabitsTrack your habits and long-term goals
First release: Aug 14, 2025
- Habo com.pavlenko.Habo
First release: Jan 18, 2026
- HabsGleich de.codecivil.habsgleich
First release: Sep 27, 2024
- Hacker for AnySoftKeyboard com.anysoftkeyboard.languagepack.hackerkeyboardlayout
First release: Jul 31, 2026
- HackersDiet de.anderdonau.hackersdiet
First release: Sep 17, 2025
Hacki com.jiaqifeng.hackiAn open-source Hacker News client.
First release: Jun 30, 2025
Håck mas Castle 2026 Schedule at.hackmas.android.scheduleFirst release: Aug 17, 2026
Hackover 2026 Schedule info.metadude.android.hackover.scheduleFirst release: Oct 8, 2026
- HACS io.mainframe.hacs
First release: Jan 10, 2026
HahaNote com.catpuppyapp.hahanoteFirst release: Aug 12, 2026
Hail com.aistra.hailFreeze Android apps
First release: Sep 9, 2024
- Halachic Prayer Times net.sf.times
First release: Jul 15, 2025
HalfDot it.davquar.halfdotHalfDot is a minimalistic client for Umami Analytics
First release: May 17, 2024
Halma app.halmaFirst release: Jan 19, 2026
Hamburger de.freehamburgerFirst release: Aug 31, 2024
- Hamfisted org.nhcham.hamfisted
First release: Jun 27, 2025
Hammer com.darkrockstudios.apps.hammer.androidA simple tool for building stories.
First release: Feb 8, 2026
Ham Test com.hazelhope.dubster.hamtestPrepare for and pass all three US Amateur Radio license exams
First release: Aug 26, 2026
- Handy Reading ru.yanus171.feedexfork
First release: Nov 8, 2025
Happy Moments com.danni.happymomentsFirst release: Jul 31, 2026
HappyTaxes io.github.dorumrr.happytaxesPrivate bookkeeping for freelancers, small business, or personal finances.
First release: Dec 19, 2025
Harbor com.monstera.harborLocal, FOSS work-profile isolation and app management
First release: Aug 13, 2026
Harmonic com.simon.harmonichackernewsFirst release: Dec 2, 2025
Harmony Music com.anandnet.harmonymusicAn Android App for streaming Music
First release: Jan 23, 2025
- Harp xyz.lepisma.harp
First release: Feb 13, 2026
- Hash Checker com.smlnskgmail.jaman.hashchecker
First release: Oct 30, 2024
- Hash Checker com.smlnskgmail.jaman.hashchecker.thirdparty
First release: Jul 31, 2026
- Hassalarm com.fjun.hassalarm
First release: Mar 24, 2025
- Hate Rate com.grappim.hateitorrateit
First release: Jan 25, 2026
Hate Rate com.grappim.hateitorrateit.fdroidFirst release: Oct 8, 2026
- Hauk info.varden.hauk
Self-hosted real-time location sharing
First release: Oct 1, 2026
- Haven io.github.kennethchoinfosec.haven
First release: Aug 1, 2026
Haven sh.haven.appSSH terminal, Wayland desktop, VNC/RDP, cloud storage & SFTP for Android
First release: Jul 31, 2026
- Hawaiian for AnySoftKeyboard com.anysoftkeyboard.languagepack.hawaiian
First release: Jul 31, 2026
Hazel com.hazel.androidDownload video and audio from over 1500 sites, powered by yt-dlp.
First release: Sep 9, 2026
- Headi com.headi.app
First release: Mar 7, 2024
- Headphone indicator de.cweiske.headphoneindicator
First release: Aug 28, 2024
- Health com.vayunmathur.health
First release: Oct 8, 2026
- Health Connect Shortcut shortcut.healthconnect
First release: Jul 31, 2026
Health Disconnect com.monkopedia.healthdisconnectView your Health Connect data in charts and widgets. Offline. Private. No ads.
First release: Oct 3, 2026
- HealthLog com.jucktion.healthlog
First release: Sep 29, 2025
- Healthy Battery Charging biz.binarysolutions.healthybatterycharging
First release: Jan 25, 2026
Heart Alert com.nikashitsa.polar_alert_androidBluetooth heart rate alarm: audio alert when your BPM leaves your custom range
First release: Sep 10, 2025
- hEARtest org.woheller69.audiometry
Quick and simple hearing evaluation
First release: Sep 5, 2025
- Heart Rate Monitor com.github.heartratemonitor_compose
First release: Aug 3, 2026
Heartwood dev.easonhuang.heartwoodA private, read-only Material You viewer for your Health Connect data.
First release: Oct 18, 2026
- HeaterRC com.dynamite.heaterrc
First release: Mar 16, 2025
Hebrew Calendar com.hebrewcalHebrew date, holidays, zmanim and Omer count on your lockscreen
First release: Sep 2, 2026
Hebrew Calendar com.heeboe.hebrewcalendarFirst release: Oct 8, 2026
HeliBoard helium314.keyboardCustomizable open-source keyboard
First release: Sep 6, 2025
- HeliBoard debug helium314.keyboard.debug
First release: Sep 6, 2025
Helio fm.helioFirst release: Dec 8, 2025
- Heliodos eu.domob.heliodos
First release: Aug 26, 2026
Hermes Agent com.hermesagent.hermes_androidFirst release: Sep 16, 2026
Hermes Mobile com.m57.hermescontrolRemote control for your Hermes AI agent
First release: Aug 13, 2026
Hestia kapoue.hestiaLocal control of Shelly devices — no cloud, no account, no tracking.
First release: Aug 12, 2026
Het Saldo dev.maartje.hetsaldoA cross-platform De Lijn "smart"ticket saldo checking application.
First release: Aug 7, 2025
HexDroid IRC com.boxlabs.hexdroidFirst release: Aug 2, 2026
- Hex Launcher com.mrmannwood.hexlauncher
First release: Sep 11, 2026
Hexpress com.castlewrath.hexpressFirst release: Sep 6, 2024
HexViewer fr.ralala.hexviewerHexadecimal viewer for Android
First release: Sep 12, 2025
HFUT-Schedule com.hfut.scheduleAll-in-one school service app for Hefei University of Technology students
First release: Sep 17, 2025
- HiddenProtectedWorkProfile hidden.protectedwp.safespace
First release: Aug 7, 2026
- HiddenSettings su.free.hiddensettings
First release: Nov 9, 2025
Hiddify app.hiddify.comFirst release: Jul 31, 2024
HideDroid it.unige.hidedroidFirst release: Mar 10, 2024
- HideMockLocation io.github.auag0.hidemocklocation
First release: Nov 12, 2024
Hidroly com.om1cael.hidrolyFirst release: Sep 20, 2025
- Hindi for AnySoftKeyboard com.anysoftkeyboard.languagepack.hindi
First release: Jul 31, 2026
hisapkitap hisapkitap.comFirst release: Oct 8, 2026
- hJOP Driver cz.mendelu.xmarik.train_manager
First release: Jul 24, 2025
- HK Transport app.hkTransport
First release: Jan 19, 2026
- HMA-OSS org.frknkrc44.hma_oss
First release: Feb 5, 2026
- holesail-go io.holesail.holesail.go
First release: Jul 10, 2024
Holidayz com.MNPDigital.holidayzFirst release: Apr 6, 2025
Holos social.holos.appHolos: Mobile-first Fediverse client with your own ActivityPub identity
First release: Oct 8, 2026
- Home io.github.domi04151309.home
First release: Jun 19, 2025
- Home Assistant io.homeassistant.companion.android
First release: Sep 7, 2025
Home Assistant io.homeassistant.companion.android.minimalFirst release: Oct 8, 2026
- HomeCentral sadLogic.HomeCentral
First release: Aug 31, 2025
- HomeFeed com.byterdevs.rsswidget
First release: Sep 1, 2025
Homer Audio Player com.studio4plus.homerplayer2Audiobooks and podcasts: simple player managed by a caregiver
First release: Sep 19, 2026
- Homer Player com.studio4plus.homerplayer
First release: Nov 23, 2024
- Hongeet com.dxku.hongit
First release: Aug 3, 2026
Hoop Draw nodomain.hoopdrawFirst release: Jun 15, 2025
HOPE 26 info.metadude.android.hope.scheduleFirst release: Oct 8, 2026
Hoplite Polytonic Greek Keyboard com.philolog.hoplitekeyboardFirst release: Jan 6, 2026
HopToDesk com.hoptodesk.appRemote Desktop Software For Personal and Business use.
First release: Apr 1, 2025
Horus com.scariflabs.horusRun Claude Code, Codex, and OpenCode in a real Linux terminal on your phone
First release: Oct 13, 2026
HostLookup de.obsp.hostlookupExplore DNS records and network information across public resolvers
First release: Sep 11, 2026
- Hot Stuff com.hotstuff
First release: Apr 13, 2024
How2Vote au.how2vote.appSee how parties' real parliamentary voting records compare with your views.
First release: Sep 16, 2026
how many? run.moritz.howmanyCount Objects in Photos
First release: Oct 11, 2026
- HRLY com.ltrademark.hourly
First release: Dec 24, 2025
- HSTempo hsware.neo
First release: Nov 17, 2025
HTTP Shortcuts ch.rmy.android.http_shortcutsSubmit HTTP Requests from Shortcuts on your Home Screen
First release: Feb 8, 2026
Huda com.aw.hudaPrayer times, Quran, Qibla, Tasbih, Adhkar and more — your Islamic companion
First release: Aug 23, 2026
Hue Sort com.sidhant.huesortA color sorting puzzle game. Swap tiles to reconstruct the hidden gradient.
First release: Sep 9, 2026
Hue Spill com.sidhant.huespillFirst release: Sep 9, 2026
- huggingAssist org.woheller69.hugassist
First release: Sep 5, 2024
- Human Benchmark io.github.printn.humanbenchmark
First release: Dec 21, 2025
- Hungarian for AnySoftKeyboard com.anysoftkeyboard.languagepack.hungarian_oss
First release: Jul 31, 2026
- Hupl eu.imouto.hupl
First release: Aug 12, 2026
Husi fr.husiFirst release: Sep 14, 2025
- Husk co.xplat.husk
First release: Sep 17, 2026
Husky su.xash.huskyHusky is a client for Pleroma and Mastodon social networks.
First release: Dec 8, 2024
- Husky Beta su.xash.husky.beta
First release: Sep 28, 2025
hwloc lstopo com.hwloc.lstopoFirst release: Jan 27, 2026
- Hydra be.ugent.zeus.hydra.open
First release: Jan 12, 2025
HyleX de.jepfa.hyle_xChaos against Order: An Entropy / Hyle 7 like board game
First release: Oct 8, 2026
- Hypatia org.maintainteam.hypatia
First release: Oct 24, 2025
- Hypatia us.spotco.malwarescanner
First release: Dec 9, 2024
- Hyperlink Knapsack me.ananas.hyperlinkknapsack
First release: Jun 6, 2025
HyperRogue com.roguetemple.hyperroidFirst release: Sep 16, 2025
HypoStats app.hypostatsSimple hypoglycemia logging and statistics, not only for diabetics.
First release: Jan 19, 2026
- I2P net.i2p.android.router
First release: Jul 31, 2026
i2pd org.purplei2p.i2pdFull-featured C++ implementation of I2P client
First release: Sep 9, 2025
- Iam Pirate Dice com.igormaznitsa.android.iampiratedice
First release: Jun 3, 2024
- Iam Pirate Dice com.igormaznitsa.piratedice
First release: Jul 31, 2026
- iBeacon Tasker io.github.smailzhu.ibeacontasker
First release: Jul 31, 2026
Ibis Wallet github.aeonbtc.ibiswalletFirst release: Jul 22, 2026
- Icelandic for AnySoftKeyboard com.anysoftkeyboard.languagepack.icelandic
First release: Jul 31, 2026
Iceraven io.github.forkmaintainers.iceravenFirst release: Aug 29, 2025
Ichaival com.utazukin.ichaivalMobile client for the LANraragi manga/doujinshi web manager
First release: Feb 18, 2025
Iconify com.drdisagree.iconifyCustomize Boring Android UI
First release: May 23, 2026
- Iconify com.drdisagree.iconify.foss
First release: Mar 2, 2025
IconRequest de.kaiserdragon.iconrequestRetrieve app icons from your installed applications
First release: Jun 6, 2025
- ICS Theme for AnySoftKeyboard com.anysoftkeyboard.theme.ics
First release: Jul 31, 2026
ICSx⁵ at.bitfire.icsdroidSubscribe to Webcal (.ics) calendars
First release: Sep 15, 2025
IdeaMemo com.ldlywt.noteFirst release: Mar 11, 2025
Idle Fantasy com.tristinbaker.idlefantasyIdle RPG: train skills, fight dungeons, craft gear. No ads, no accounts.
First release: Aug 2, 2026
idTech4A++ com.karin.idTech4AmmFirst release: Aug 10, 2025
IED at.krixec.iedFirst release: May 30, 2025
- IETF 121 org.ietf.ietfsched
First release: Mar 20, 2025
- Igatha com.nizarmah.igatha
First release: Apr 28, 2025
IITC Mobile org.exarhteam.iitc_mobileIITC-CE map for Ingress Prime game
First release: Aug 29, 2025
I Keep Having This Dream com.fireflame.dreamBuild a path of tiles to escape each cycle of a dangerous recurring dream
First release: Aug 16, 2026
IM2SMS com.goldmaster.im2smsA simple app to import IM chat histories into Android’s SMS storage.
First release: Aug 14, 2026
Image Compressor io.ahxxm.icCompress JPEG/PNG images using mozjpeg or jpegli offline
First release: Sep 3, 2026
Image Converter biz.binarysolutions.imageconverterFirst release: Nov 12, 2025
Image Meta Cleaner code.alimiracle.image_meta_cleanerFirst release: Oct 7, 2026
- Imagepipe de.kaffeemitkoffein.imagepipe
First release: Jan 4, 2026
ImageType com.ahmedsamy.imagetypeText-on-image: blind-first, offline, private, zero AI, minimal perms.
First release: Oct 7, 2026
- ImapLocate org.woheller69.ImapLocate
First release: Aug 21, 2025
- ImapNotes3 de.niendo.ImapNotes3
First release: Feb 1, 2026
IMD com.soul_99.suIMDSettings manager/ hide settings from apps
First release: Sep 7, 2026
- ImgurViewer com.ensoft.imgurviewer
First release: Nov 7, 2025
ImmichUploader com.exner.tools.immichuploaderApp that can upload media files to your Immich instance.
First release: Feb 3, 2026
- Impostor MX com.impostormx.org
First release: Jul 31, 2026
Improvement Roll com.improvement_rollCreate a list of productive things to do and improve yourself one task at a time
First release: Apr 16, 2025
- Inbox Pager net.inbox.pager
First release: Jul 6, 2024
Indic Keyboard org.smc.inputmethod.indicThe first Android keyboard for Indian languages. Open source, no ads.
First release: Oct 17, 2024
- Indonesian for AnySoftKeyboard com.anysoftkeyboard.languagepack.indonesian
First release: Jul 31, 2026
- InfiniList uk.sensoryunderload.infinilist
First release: Jan 20, 2025
- Infinity ml.docilealligator.infinityforreddit.patreon
First release: Sep 18, 2025
- Infinity+ ml.docilealligator.infinityforreddit.plus
First release: Sep 18, 2025
- Inflation Calculator fr.corenting.convertisseureurofranc
First release: Apr 27, 2025
- Infomaniak Mail com.infomaniak.mail
First release: Feb 10, 2026
Infra Arcana camp.werewolf.infraarcanaInfra Arcana - a Lovecraftian horror roguelike
First release: Aug 21, 2026
Initiative Tracker io.github.potsdam_pnp.initiative_trackerFirst release: Sep 25, 2025
Inkcast dev.inkcast.aosFirst release: Oct 8, 2026
- inkOS app.inkos
First release: Sep 1, 2025
Inner Breeze io.naox.inbeFirst release: Mar 17, 2025
Inner Breeze xyz.waozi.inbeLumi guides your day: breathing, meditation, yoga, habits, lists and a diary.
First release: Jul 30, 2026
InnerTune com.malopieds.innertuneA fork of InnerTune, a Material 3 YouTube Music client for Android
First release: Mar 23, 2025
InnerTune com.zionhuang.musicA Material 3 YouTube Music client for Android
First release: Sep 1, 2024
InselChaos 2026 info.metadude.android.inselchaos.scheduleFirst release: Sep 3, 2026
- Insigno org.mindshub.insigno
First release: Jul 1, 2025
insporation* jhass.eu.insporationFirst release: Feb 2, 2024
InstaDownload com.vakarux.instadownloadDownload Instagram media to your device
First release: Jul 26, 2026
- Install with Options dev.zwander.installwithoptions
First release: Sep 21, 2025
INSTEAD org.emunix.insteadlauncherInteractive fiction games
First release: Nov 15, 2024
- Intent Intercept de.k3b.android.intentintercept
First release: Jun 27, 2025
Internet Helper for Gadgetbridge nodomain.freeyourgadget.internethelperCompanion app for Gadgetbridge, to allow for controlled Internet access
First release: Aug 29, 2026
Internet Radio com.armanmaurya.internetradioDiscover and listen to thousands of free internet radio stations worldwide.
First release: Jul 31, 2026
- Inter Profile Sharing digital.ventral.ips
First release: Oct 31, 2024
Interstellar one.jwr.interstellarAn open source Mbin & Lemmy client, connecting you to the fediverse.
First release: Sep 22, 2025
InterTune dev.skye.intertuneMaterial 3 local music player and YouTube Music client
First release: Oct 17, 2026
Interval Timer dev.randombits.intervaltimerFirst release: Sep 8, 2025
- Interval Timer org.secuso.privacyfriendlyintervaltimer
First release: Jul 15, 2025
Intra app.intraFirst release: Jan 19, 2026
Intruder Selfie com.tharunbirla.intruderselfieCatches snoopers! Secretly snaps photos of anyone who tries to unlock your phone.
First release: Jul 19, 2025
Inure app.simple.inureFast, refined app manager for power users, with root and Shizuku support.
First release: Jan 19, 2026
Inventory com.codelv.inventoryFirst release: Jan 16, 2026
InviZible Pro pan.alexander.tordnscryptFirst release: Sep 24, 2025
- InviZible Pro pan.alexander.tordnscrypt.stable
First release: Oct 1, 2025
- Invoice Ninja com.invoiceninja.app
First release: Nov 14, 2025
- Ion Launcher one.zagura.IonLauncher
First release: Jun 9, 2025
- IPCalc fr.jnda.android.ipcalc
First release: Nov 14, 2025
IPCam Demo com.github.niqdev.ipcamFirst release: Oct 25, 2024
iPerf3Client com.example.iperf3clientiPerf3 is a tool for active measurements of the max bandwidth on IP networks.
First release: Nov 16, 2025
IPTVMine Pro com.samyak.iptvmineproFirst release: Oct 8, 2026
- IPTV Player com.broscr.iptvplayer
First release: Sep 16, 2024
- IPv6Droid de.flyingsnail.ipv6droid
First release: Jun 7, 2025
- IP Wizard lk.thisald.ipwizard
First release: Nov 17, 2025
IR Blaster Remote org.nslabs.ir_blasterAnother Universal IR remote: Hex/Raw, Flipper Zero, LIRC, IRPlus + Signal Tester
First release: Feb 2, 2026
IReader ir.kazemcodes.infinityreaderModern ebook reader for Android
First release: Aug 4, 2025
- IReader ir.kazemcodes.infinityreader.preview
First release: Feb 11, 2026
Iremi eu.ziclaud.iremibreathingappApp that gives breathing exercises to reduce anxiety
First release: Oct 8, 2026
IRemote app.iremoteConfigurable IR Remote
First release: Jan 19, 2026
IREX Mobile App space.irex.mobileIREX mobile application
First release: Feb 8, 2024
iris to.irisFirst release: Oct 8, 2026
- Iris nabu.iris.keyboard
First release: Aug 23, 2026
IRIS nini22p.irisFirst release: Feb 23, 2025
- IrisChat com.nemesis.irischat
First release: Sep 22, 2024
IrisChat com.umut.irischatA modern, privacy-respecting IRC client for Android
First release: Aug 24, 2026
Iris Gallery com.iris.galleryFast, private, 100% offline gallery with photo editor and EXIF inspector
First release: Aug 27, 2026
IronFox org.ironfoxoss.ironfoxFirst release: Sep 17, 2025
- Irregular Expressions mf.asciitext.lite
First release: Jul 31, 2021
- IR Remote us.spotco.ir_remote
First release: Apr 24, 2024
- Is it Prime com.bbzone.isitprime
First release: Dec 1, 2025
- Island com.oasisfeng.island.fdroid
First release: Aug 7, 2025
- Isotope Browser iaea.nds.nuclides
First release: Dec 18, 2024
iSpindle Plotter com.ispindle.plotterCollect and plot fermentation data from an iSpindel hydrometer.
First release: Oct 5, 2026
- Israel 64 BDay Theme com.anysoftkeyboard.theme.israel64
First release: Jul 31, 2026
- Italian for AnySoftKeyboard com.anysoftkeyboard.languagepack.italian
First release: Jul 31, 2026
- Ithaka Board Game eu.veldsoft.ithaka.board.game
First release: Jul 31, 2026
- Itinerary Planner com.pixelarry.itinerary_planner
First release: Nov 17, 2025
- iTracing2 net.sylvek.itracing2
First release: Jan 15, 2024
- iTrack workout tracker com.iTrack.app
First release: Jul 31, 2026
IVPN net.ivpn.clientPrivacy focused VPN service with WireGuard
First release: Feb 20, 2025
iyox Wormhole com.iyox.wormholeSecure, open-source file sharing
First release: Aug 17, 2025
- IYPS com.iyps
First release: Aug 4, 2025
- IzzyOnDroid in.sunilpaulmathew.izzyondroid
First release: Nov 6, 2025
J2ME Loader ru.playsoftware.j2meloaderFirst release: Aug 7, 2024
- JABtalk com.jabstone.jabtalk.basic
First release: Sep 10, 2024
Jalali Persian Calendar com.cocode.calendarGregorian and Persian (Jalali) calendar with a two-way date converter
First release: Oct 11, 2026
Jaliscope com.audiosoftware.jaliscopeA vectorscope program centered around performance, accuracy, and customizability
First release: Oct 4, 2026
Jamfish org.adrianvictor.geleiaFirst release: Oct 8, 2026
Jami cx.ringFirst release: Aug 5, 2026
Jamu jp.nonbili.jamuFirst release: Dec 21, 2025
- JaMuz org.phramusca.jamuz
First release: Jul 31, 2026
Janken (Rock Paper Scissors) com.attenomy.jankenModern offline Rock Paper Scissors with private Pass & Play, Bot AI and RPSLS.
First release: Sep 17, 2026
Janus Glossa com.anysoftkeyboard.janusContextual translations using Wikipedia's knowledge graph.
First release: Jan 13, 2026
Jargon com.hackerapps.jargonOffline reader for the Jargon File, the original hacker culture dictionary
First release: Jul 28, 2026
Jasstafel ch.simonste.jasstafelVery flexible Jass board to write points at the Schieber, Coiffeur, Molotov.
First release: Jan 23, 2026
Java OOP Quiz io.oopquizz.oopquizTests Your knowledge of Java Object-Oriented Programming.
First release: Mar 19, 2025
JekyllEx xyz.jekyllexThe mobile IDE to create, build, edit, preview, and publish Jekyll sites.
First release: Aug 15, 2025
JellyBook com.KaraWilson.JellyBookFirst release: Feb 19, 2024
Jellyfin org.jellyfin.androidtvFirst release: Feb 4, 2026
Jellyfin org.jellyfin.mobileFirst release: May 16, 2025
JemRec com.jemcik.jemrecRecords phone, WhatsApp, Telegram, Viber and Meet calls, both sides, no root
First release: Oct 9, 2026
- Jerboa com.jerboa
First release: Feb 7, 2026
JetBird dev.bg.jetbirdAn unofficial, FLOSS, native Android NetBird client built with privacy in mind
First release: Nov 12, 2025
- Jetpack com.jetpack.android
First release: Feb 9, 2026
- JetSpacer com.sakethh.jetspacer
First release: Nov 16, 2024
Jigsaw com.sidhant.jigsawA beautifully tactile, relaxing jigsaw puzzle game
First release: Sep 20, 2026
Jigsaw io.gitlab.derjosef.jigsawFirst release: Oct 8, 2026
Jitsi Meet org.jitsi.meetFirst release: Nov 12, 2025
- J-K Bike - Mechanical Disaster Prevention com.exner.tools.jkbikemechanicaldisasterprevention
First release: Feb 26, 2025
- J-K Bike - Mechanical Disaster Prevention com.exner.tools.jkbikemechanicaldisasterprevention.light
First release: Jul 31, 2026
JMdict droid fr.ryder.benoit.jmdictdroidFirst release: Feb 9, 2025
JMP SIM Manager chat.jmp.simmanagerFirst release: Aug 19, 2026
Joplin net.cozic.joplinA note taking and to-do app with sync between Linux, macOS, Windows, and mobile
First release: Sep 1, 2025
Jotdown br.com.jotdownOffline PDF reader with OCR and academic annotations.
First release: Sep 9, 2026
- Jotter com.openappslabs.jotter
First release: Jan 26, 2026
Journal com.isaakhanimann.journalFirst release: Oct 8, 2026
- Journalize com.example.journal
First release: Aug 20, 2025
Journal Multilingual in.kawaiis.journalOpen-source drug use tracker with interaction checker and multilingual support.
First release: Aug 5, 2026
- Jpeg XL Viewer fr.oupson.jxlviewer
First release: Sep 16, 2025
JPortal in.codelif.jportal.androidUnofficial app for the JIIT webportal: attendance, marks, grades and exams
First release: Oct 9, 2026
- jQuarks com.oF2pks.jquarks
First release: Jul 10, 2024
JRBP Survey io.github.samcrow.jrbpsurveyFirst release: Oct 8, 2026
- JRBP Survey org.samcrow.jrbpsurvey
First release: Mar 26, 2019
- JRPN 15C com.jovial.jrpn15
First release: Jun 17, 2025
JRPN 16C com.jovial.jrpn2First release: Oct 8, 2026
JS-Dict io.github.petlyh.jsdictFirst release: Sep 20, 2024
- jSlide2 fdr.ioi.jslide2
First release: Jul 31, 2026
- Json List com.sjapps.jsonlist
First release: May 22, 2025
- jtx Board at.techbee.jtx
First release: Sep 18, 2025
- Just Delete Me com.amanoteam.kurt
First release: Jan 27, 2026
- Just Listen com.rld.justlisten.android
First release: Oct 10, 2024
- just open links in a browser io.github.rastislavpapp.justopenlinksinabrowser
First release: Aug 28, 2026
Just Player (Legacy) com.brouken.playerSimple video player based on ExoPlayer library
First release: Jan 26, 2026
- JustWeather com.jjewuz.justweather
First release: Dec 2, 2024
Jyutping org.jyutping.jyutpingFirst release: Jan 30, 2026
K-19 Player ch.ulys.k19playerFirst release: May 8, 2024
K-9 Mail com.fsck.k9First release: Feb 10, 2026
KabelWacht com.github.muelli.kabelwachtA simple, free WireGuard VPN client: scan, import, and manage tunnels.
First release: Sep 20, 2026
- Kachin for AnySoftKeyboard com.anysoftkeyboard.languagepack.kachin
First release: Jul 31, 2026
Kafka IA com.kafka.userFirst release: Oct 9, 2024
Kahon com.amanoteam.kahonA fork of Mihon with some annoying restrictions removed
First release: Aug 10, 2025
Kairos com.skohscripts.kairosYour tasks in the right order, fitted into your day. No account, no network.
First release: Oct 2, 2026
Kakugo org.kaquiLearn Japanese with Kakugo
First release: Jan 12, 2026
- Kakuro com.sidhant.kakuro
First release: Sep 27, 2026
Kalimory io.github.wildebeast2521.kalimoryCalm, offline bodyweight training with guided workouts and progressions
First release: Oct 31, 2026
Kanji Dojo ua.syt0r.kanji.fdroidLearn & practice writing Japanese characters
First release: Aug 12, 2025
Karabau com.ruizlenato.karabauNative Android client for Karakeep to save, organize, and manage bookmarks.
First release: Jul 30, 2026
kardi notes github.rikodot.kardi_notesCross-platform app to take notes. Encrypted, open-source, sync across devices.
First release: Feb 6, 2025
- Karma FW net.stargw.fok
First release: Aug 13, 2024
Karui io.github.ronynn.karui130kB aesthetic offline todo list app with calendar, sync and widgets
First release: Mar 27, 2025
Käsekästchen de.stefan_oltmann.kaesekaestchenFirst release: Oct 8, 2026
- Kasette com.kasette.app
First release: Sep 16, 2026
KashCal org.onekash.kashcalAll your calendars in one app. iCloud, CalDAV, device, ICS. Private.
First release: Feb 14, 2026
- Katawa Shoujo: Re-Engineered sh.fhs.ksre
First release: Sep 29, 2026
Kazumi com.predidit.kazumiAn anime collection APP based on custom rules.
First release: Sep 25, 2025
- Kblack: Offline Map Navigation com.kblack.offlinemap
First release: Aug 3, 2026
- KC3ICT Ham Study com.neyhard.hamstudy
First release: Jul 31, 2026
kDrive com.infomaniak.driveThe most secure cloud in Europe for SMEs and private individuals.
First release: Feb 7, 2026
KeepADB de.hohnepeople.keepadbKeep Wireless Debugging active and toggle it from a tile or widget
First release: Sep 27, 2026
- Keep Alive io.keepalive.android
First release: Apr 19, 2025
- Keep Alive Lite io.keepalive.lite.android
First release: Jul 31, 2026
- Keepass2Android Offline keepass2android.keepass2android_nonet
First release: Sep 26, 2025
KeePassDroid com.android.keepassKeePass-compatible password safe
First release: Apr 20, 2025
Keepass Fidelity net.helcel.fidelityFirst release: Jun 28, 2024
- KeePassVault com.ivanovsky.passnotes
First release: May 22, 2025
Keeper io.hexawallet.bitcoinkeeperFirst release: Sep 19, 2025
keepIT org.hyperstarit.keepitappNotes, checklists and voice notes. Offline-first, synced on your own server.
First release: Sep 27, 2026
- Keep it up net.ibbaa.keepitup
First release: Feb 8, 2026
- KeepOn fr.twentynine.keepon
First release: Aug 24, 2025
Keep Screen On com.elasticrock.keepscreenonA screen timeout quick settings tile
First release: Dec 31, 2025
- Keet io.keet.app
First release: Sep 22, 2025
Keet io.keet.chatFirst release: Oct 1, 2026
Kefir Control eu.raulmorales.kefircontrolMinimalist app to track milk kefir, water kefir, and kombucha fermentation times.
First release: Oct 8, 2026
KeinPlan io.github.ezberlin.keinplanFirst release: Aug 16, 2026
Kelani SBD Tracker com.kelani.sbdtrackerFirst release: Aug 5, 2026
- Kelani SBD Tracker com.kel.powerlifting
First release: Jul 29, 2026
Kenko com.looker.kenkoFirst release: Nov 13, 2025
Kepler-App de.keplerchemnitz.kepler_appFirst release: Jun 7, 2025
Kernel Flasher com.github.capntrips.kernelflasherFirst release: Apr 16, 2025
- KernelSU me.weishu.kernelsu
First release: Apr 23, 2025
Keryx works.merc.keryxOne reader. Every device. Local-first RSS reader with optional cloud sync.
First release: Oct 10, 2026
Kettu Manager cocobo1.pupu.managerFirst release: May 27, 2025
Keyboard org.fossify.keyboardSimple and open-source offline keyboard with emojis
First release: Aug 22, 2025
- Keyboard Layout Companion io.github.colemakmods.keyboard_companion
First release: Sep 18, 2025
- KeyboardS com.kunzisoft.keyboard.switcher
First release: Jan 23, 2026
- KeyGo de.davis.passwordmanager
First release: Feb 10, 2024
Keyguard com.artemchep.keyguardFirst release: Sep 16, 2025
- Keyholm app.keyholm
Single-device passkeys on secure hardware
First release: Oct 27, 2026
Keyman com.tavultesoft.kmaproFirst release: Sep 26, 2025
Key Mapper io.github.sds100.keymapperMake shortcuts for ANYTHING! Remap volume, power, keyboard, or floating buttons!
First release: Feb 7, 2026
Key Mapper GUI Keyboard io.github.sds100.keymapper.inputmethod.latinThe official companion keyboard for Key Mapper.
First release: Jan 23, 2025
Keyoxide org.keyoxide.keyoxideFirst release: Apr 12, 2025
- KeyPass com.yogeshpaliyal.keypass
First release: Sep 3, 2025
- Keysh io.github.hufrea.keysh
First release: Feb 14, 2025
- KeyStoreViewer com.seiko.keystoreviewer
First release: Jul 21, 2024
KFZ-A de.herk.kfzaOffline lookup of Austrian vehicle registration identifiers
First release: Sep 14, 2026
KFZ-D de.herk.kfzdOffline lookup of German vehicle registration identifiers
First release: Sep 15, 2026
- Khushu com.kaizen.khushu
First release: Aug 3, 2026
Kid3 net.sourceforge.kid3Kid3 Audio Tagger
First release: Oct 12, 2026
kiFOSSk com.shinydiscoballsdev.kifosskLightweight FOSS kiosk browser for dashboards. Auto-recovery, zero Google.
First release: Aug 5, 2026
Kinetica com.kinetica.keyboardTwo-thumb keyboard: both thumbs swipe and tap at once. No network access.
First release: Aug 26, 2026
kingdomino_score_count fr.odrevet.kingdomino_score_countCalculate your "Kingdomino" and "Kingdomino Age of Giants" score easily
First release: Aug 17, 2025
KingInstaller com.example.kinginstallerFirst release: Aug 27, 2026
King Pong com.kingalex.kingpongRetro Pong campaign with multiplayer and a secret ending
First release: Sep 27, 2026
- King Post com.kingalexgilbert.kingpost
First release: Aug 10, 2026
- Kin nai D com.icesu.kinnaid
First release: Oct 3, 2024
Kiosk com.shapeshed.kioskA Hacker News reader for Android.
First release: Aug 14, 2026
- KISS launcher fr.neamar.kiss
First release: Dec 11, 2025
KitchenOwl com.tombursch.kitchenowlFirst release: Sep 21, 2025
kitshn de.kitshn.androidAn unofficial client for the self-hosted Tandoor recipe management software.
First release: Feb 7, 2026
- kitshn de.kitshn.android.nightly
First release: Nov 3, 2024
Kitsune io.github.drumber.kitsuneDiscover and track anime and manga on Kitsu, with feeds, groups and reactions.
First release: Feb 23, 2025
KitX com.crequency.kitx.mobileFirst release: Apr 18, 2023
Kiwix org.kiwix.kiwixmobile.standaloneOffline Wikipedia reader
First release: Feb 13, 2025
Kizzy com.my.kizzyDiscord Rich Presence
First release: Dec 15, 2025
Klick'r com.buzbuz.smartautoclickerFirst release: Sep 13, 2025
- Klock com.koshai_limited.klock
First release: Aug 15, 2024
kMeet com.infomaniak.meetFree and secure videoconferencing solution
First release: Feb 1, 2026
KMySync de.spahr.ausgabenMobile companion for KMyMoney — record cash expenses on the go
First release: Oct 23, 2026
KnightStalker org.knightstalker.appOpen-source Stalker IPTV client for Android
First release: Aug 17, 2026
Knit app.getknit.knitEncrypted mesh chat over Wi-Fi Aware & Bluetooth — no internet, no servers.
First release: Aug 3, 2026
knkpanime com.example.knkpanimeAnime app with multiple source and danmaku support
First release: Feb 1, 2025
- Knock on Ports me.impa.knockonports
First release: Feb 8, 2026
Knocky com.rekna.knockyFirst release: Feb 10, 2026
Knotwork app.knotwork.androidAn AI agent that runs on your phone and asks before it acts
First release: Oct 16, 2026
KnoxPatch io.mesalabs.knoxpatchGet Samsung apps/features working again in your rooted Galaxy device.
First release: Jul 16, 2025
- Kochi Transit Go app.agneldev.kochitransitgo
First release: Jul 31, 2026
Kodi org.xbmc.kodiFirst release: Mar 8, 2025
koduko com.example.kodukoFirst release: Jun 26, 2024
Kokoro TTS dev.kokoro.ttsText-to-speech engine that speaks through your own Kokoro server
First release: Oct 13, 2026
Komelia io.github.snd_r.komeliaKomga media client
First release: Jan 23, 2026
Komikku app.komikkuFirst release: Sep 15, 2025
Komi Store zed.rainxch.githubstoreApp store for GitHub releases - discover and install apps with one click
First release: Jan 6, 2026
Komodo Wallet com.komodoplatform.komodowalletFirst release: Nov 12, 2025
Kompact com.kompactOffline image editor, compressor, resizer and converter.
First release: Aug 11, 2026
Kompanion com.adpa1013.kompanionFirst release: Sep 20, 2026
- Kõnele ee.ioc.phon.android.speak
First release: Mar 6, 2024
Koofr Vault net.koofr.vaultOpen source, client-side, zero-knowledge encrypted storage application by Koofr
First release: Jan 19, 2026
- Kords com.vipedev.kords
First release: Jun 30, 2025
Kords com.vipedev.kords2A ukulele chords dictionary and songbook.
First release: Jul 10, 2026
- Kore org.xbmc.kore
First release: Jan 26, 2024
KOReader org.koreader.launcherFirst release: Aug 16, 2025
KOReader org.koreader.launcher.fdroidFirst release: Oct 8, 2026
- Kotatsu org.koitharu.kotatsu
First release: Aug 30, 2025
- KotlinQuiz com.example.kotlinquiz
First release: Jul 31, 2026
Kreate me.knighthat.kreateA multilingual YouTube Music frontend for Android, prioritize performance.
First release: Sep 18, 2025
Kryfo app.kryfoFirst release: Oct 8, 2026
Kryptos com.kryptos.androidEncrypt inside any messenger: the keyboard encrypts, the screen decrypts
First release: Aug 3, 2026
kSync com.infomaniak.syncAutomatically sync your contacts and calendars
First release: Apr 14, 2024
KüA-Plan de.mintux.kueaplanFirst release: Jul 31, 2026
- KUKSA Companion App org.eclipse.kuksa.companion
First release: Feb 16, 2024
- Kurdish for AnySoftKeyboard com.anysoftkeyboard.languagepack.kurdish
First release: Jul 31, 2026
KurobaEx com.github.k1rakishou.chanFree and open source image board browser
First release: Jan 18, 2026
Kvaesitso de.mm20.launcher2.releaseA search-focused, free and open source launcher for Android
First release: Jul 4, 2025
- Kwik DEM (ant.spl) player.efis.data.ant.spl
First release: Oct 16, 2025
- Kwik DEM (eur.rus) player.efis.data.eur.rus
First release: Jul 31, 2026
- Kwik DEM (pan.arg) player.efis.data.pan.arg
First release: Jul 31, 2026
- Kwik DEM (sah.jap) player.efis.data.sah.jap
First release: Jul 31, 2026
- Kwik DEM (usa.can) player.efis.data.usa.can
First release: Jul 31, 2026
- Kwik DEM (zar.aus) player.efis.data.zar.aus
First release: Jul 31, 2026
- Kwik DMAP player.efis.mfd
First release: Jul 1, 2020
Kwik EFIS player.efis.pfdAviation Glass Cockpit / EFIS with ADS-B Traffic display
First release: Oct 12, 2026
Kwik EFIS (E-Ink) player.efis.pfd.inkAviation Glass Cockpit / EFIS with ADS-B for E-Ink devices
First release: Oct 12, 2026
- KyuubiMask com.rtneg.kyuubimask
First release: Aug 2, 2026
L5RCM Companion com.l5rcm.companionFirst release: Jul 28, 2026
L9 life.furrer.l9Home screen launcher for D-pad and T9 keypad phones
First release: Oct 4, 2026
Lab+ dev.labplus.appYour unofficial Companion for Gitlab
First release: Aug 27, 2024
- LabCoat com.commit451.gitlab
First release: Apr 22, 2024
- LaBLEr io.github.toolicious.labler
First release: Aug 14, 2026
- LabLog si.uni_lj.fe.lablog
First release: Aug 12, 2025
LabNex com.labnex.appFirst release: Dec 30, 2025
Ladefuchs app.ladefuchs.androidShows the cheapest charging card - with only one swipe at the charging point.
First release: Jan 19, 2026
La et Le com.languageapp.laetleFirst release: Feb 3, 2026
- Lalumo com.lalumo.app
First release: Nov 12, 2025
Language Dex dev.arthurcose.languagedexCreate custom dictionaries and retain words with puzzles.
First release: Dec 1, 2025
Lanis io.github.alessioc42.sphFirst release: Nov 28, 2025
LANShield org.distrinet.lanshieldFirst release: Jul 31, 2025
Lantern Sudoku io.github.ukpratik.lanternsudokuCalm, readable sudoku with hints that teach. No ads, no game over, offline.
First release: Oct 12, 2026
Last Launcher nl.bw20.last_launcherMinimal text-only launcher focused on speed and simplicity
First release: Oct 15, 2026
- Latarka com.kuniec.latarka
First release: Jul 31, 2026
LatentJam io.github.nikitasud.latentjam.kmpLocal music player with an on-device recommender. No account, no network.
First release: Sep 23, 2026
Latin Defense io.github.bommbomm34.latindefenseFirst release: Jan 6, 2026
- Latvian for AnySoftKeyboard com.anysoftkeyboard.languagepack.latvian
First release: Jul 31, 2026
Launch com.guruswarupa.launchFirst release: Aug 2, 2025
- Launch com.guruswarupa.launchh
First release: Jan 9, 2026
- Launch Chat org.vinaygopinath.launchchat
First release: Feb 10, 2026
Launcher org.fossify.homeCustomize your home screen with a fast, ad-free, open-source launcher
First release: Sep 17, 2025
Launcher:3 app.murinelauncherA modern, lightweight Launcher3 fork for an enhanced stock++ Android experience.
First release: Sep 3, 2026
Launcher314 com.bearinmind.launcher314Launcher with deep customization on a single screen
First release: Aug 2, 2026
- Launchpad com.devrinth.launchpad
First release: May 25, 2025
Launch-R com.resurrect.launch_rFind your space.
First release: Oct 16, 2026
- LaunchTime com.quaap.launchtime
First release: Mar 12, 2025
- LaundryNotes org.eagsoftware.laundrynotes
First release: Dec 10, 2025
- LavSeeker org.woheller69.lavatories
LavSeeker shows toilets listed in OpenStreetMap
First release: Sep 29, 2025
Lawnchair app.lawnchairFirst release: Oct 7, 2026
- Lawnchair app.lawnchair.nightly
First release: Jan 23, 2026
- Lawnchair ch.deletescape.lawnchair
First release: Jul 23, 2018
Lawnicons app.lawnchair.lawniconsFirst release: Jun 7, 2025
- Layout Editor com.itsvks.layouteditor
First release: Mar 15, 2024
L×Box com.leadaxe.lxboxVPN client: 12+ protocols, subscriptions, app routing, balancing, traffic stats
First release: Sep 9, 2026
LCDPet today.notfeelingit.lcdpetFirst release: Oct 8, 2026
- LCTerm com.vermont.possin
First release: Dec 9, 2025
- Leafpad com.git.amarradi.leafpad
First release: Aug 11, 2025
- LeanType com.leanbitlab.leantype
Private, customizable open-source keyboard with smart productivity tools
First release: Jul 29, 2026
- Learn vdrs.sappu.lafk.learn
First release: Feb 28, 2024
Learn Math com.sidhant.learnmathA modern, fast, and tactile mental math training game
First release: Sep 7, 2026
- LearnTube com.learntube.app
First release: Jul 31, 2026
Lector io.github.quantember.lectorFirst release: Oct 8, 2026
Leftovers com.leftovers.appPrivate expense tracker: log in two taps and see what is safe to spend today.
First release: Oct 23, 2026
- Legacy Photo Frame com.srkovnar.legacyphotoframe
First release: Aug 6, 2026
- Legado io.legado.app.release
First release: Aug 16, 2024
- Lembra com.lembra.app
First release: Jul 31, 2026
- Lemmy Redirect dev.zwander.lemmyredirect
First release: Aug 7, 2025
- LeMondeRssReader org.mbach.lemonde
First release: Jul 18, 2025
Lemuroid com.swordfish.lemuroidAll in one emulator on Android
First release: Oct 22, 2024
LensCast com.raulshma.lenscastTurn your phone into a networked camera: web, MJPEG and RTSP streaming
First release: Oct 24, 2026
Lens HRV com.lenshrv.fossMeasure heart-rate variability with your phone camera, no extra sensors
First release: Sep 12, 2026
- Lernkarten Eule com.koje.cards
First release: Mar 5, 2024
Les Pas site.leos.apps.lespasA photo album that saves all your precious memory in your private cloud
First release: Sep 21, 2025
- Les Sons en Français fr.richoux.lessonsenfrancais
First release: Sep 8, 2024
LessPass com.lesspass.androidFirst release: Apr 5, 2025
Let Me Downgrade com.berdik.letmedowngradeAdd support for downgrading apps on Android 12 through 17.
First release: Jan 6, 2025
- Let's Bend de.schliweb.bluesharpbendingapp
First release: Aug 29, 2025
Let's Connect! org.letsconnect_vpn.appFirst release: Nov 2, 2026
LetterBox ch.cryptobit.letterboxLearn letters with animal pictures: a simple, offline game for young children
First release: Sep 3, 2026
Levyra com.luc4n3x.levyraNative music streaming, playback, lyrics, downloads, and private insights
First release: Aug 21, 2026
- Lexica com.serwylo.lexica
First release: Jul 23, 2024
- LibChecker com.absinthe.libchecker
First release: Nov 23, 2025
- Libellus Potionis de.godisch.potillus
First release: Sep 1, 2026
- LibreAAC org.libreaac.app
First release: Aug 3, 2026
Libre Camera com.iakmds.librecameraModern camera app to take pictures and record videos
First release: Dec 25, 2025
Libre Contacts Backup com.ashkanrafiee.librecontactsbackupOffline contact backups with optional encryption
First release: Aug 23, 2026
LibreCrate com.librecrate.appPrivate offline vault for your documents and notes
First release: Oct 3, 2026
LibreCuts com.tharunbirla.librecutsLibreCuts is a free, open-source privacy friendly video editor for Android.
First release: Jul 31, 2026
LibreFit org.librefit.appFree, open source and private workout tracker with a rich dataset and images.
First release: Jul 29, 2026
- Libre Home com.krzysztofsroga.librehome
First release: May 20, 2020
Libre Librivox Listener io.gitlab.libre_librivox_listenerAn unofficial libre application to listen to public domain audiobooks.
First release: Oct 30, 2025
- LibreLynx Lite com.librelynx.lite
First release: Nov 6, 2025
Libre Memory Game org.quentin_bettoum.librememorygameFirst release: Jan 8, 2026
LibreNotes dev.librenotes.appPrivate, self-hosted, end-to-end encrypted note-taking.
First release: Aug 23, 2026
- LibreOffice 2024 Schedule info.metadude.android.libreoffice.schedule
First release: Jul 31, 2026
LibreOffice Viewer org.documentfoundation.libreofficeFirst release: Jul 31, 2026
- LibrePass dev.medzik.librepass.android
First release: Oct 19, 2024
LibrePods me.kavishdevar.librepodsFirst release: Oct 16, 2026
LibreStatus com.vaishnavmandlik.librestatusFirst release: Jul 28, 2026
- LibreSudoku com.kaajjo.libresudoku
First release: Mar 5, 2025
LibreTorrent org.proninyaroslav.libretorrentCopylefted libre software torrent client.
First release: Aug 12, 2025
LibreTrack org.proninyaroslav.libretrackPrivate, cross-platform package tracking app.
First release: Dec 30, 2024
Libro com.innomatic.libroFirst release: Aug 23, 2025
Lichess org.lichess.mobileV2First release: Aug 31, 2025
- Liedgutverzeichnis de.thefeiter.liedgutverzeichnis
First release: Apr 1, 2024
- Life Counter fr.nogafam.lifecounter
First release: Apr 10, 2024
Life Dashboard com.owen282000.lifedashboardHealth Connect and screen time to Home Assistant, MQTT or webhooks. No cloud.
First release: Oct 21, 2026
- LifeMeter dk.cocode.lifemeter
Your birthdate turned into a live dashboard of numbers about your life
First release: Oct 3, 2026
- liftmath io.github.munzzyy.liftmath
Gym calculator: 1RM, plates, warm-ups, strength scores, records, rest timer
First release: Oct 3, 2026
Lifyzer com.lifyzerFirst release: May 20, 2020
Lighthouse PM com.jeroen1602.lighthouse_pmPower management app to control the Valve Index® lighthouses from your phone.
First release: Apr 21, 2025
LightNovelReader indi.dmzz_yyhyy.lightnovelreaderLight novel reader with multiple sources
First release: Sep 24, 2025
LimeLog com.limecore.workouttrackerTrack your lifts and beat your personal records
First release: Aug 17, 2026
- Limitless Grid Live Wallpaper cxa.gridwallpaper
First release: Jul 31, 2026
- limpazap com.lucao.limpazap
First release: Aug 24, 2025
- LineShield mx.sixseven.crtlineas
First release: Jul 31, 2026
Link Clear app.linkclearStrip tracking parameters from links. Offline, private, no permissions.
First release: Oct 7, 2026
- LinkDroid for Linkwarden com.sbv.linkdroid
First release: Jan 5, 2026
- Linked Camera com.linkedcamera.app
First release: Jan 2, 2026
- LinkGuardian dev.elbullazul.linkguardian
First release: Jun 20, 2025
LinkHub com.amrdeveloper.linkhubSimple and effective link management app that can help you to mange links easily
First release: Feb 21, 2026
Linklater org.yrovas.linklaterFirst release: Aug 11, 2025
LinkLift com.rjnsdev.linklift.appYouTube & Instagram video downloader. Save HD videos, Reels, Shorts & audio.
First release: Oct 10, 2026
Linkora com.sakethh.linkoraFirst release: Feb 6, 2026
- Linkora com.sakethh.linkora.preview
First release: Aug 26, 2026
Link QR Wallet com.cocode.linkqrwalletTurn URLs into QR codes and save them in a searchable offline library
First release: Oct 18, 2026
Linkstow com.byarchitect.linkstowUnofficial Karakeep client: read, sort and clean up your self-hosted bookmarks
First release: Oct 11, 2026
Linphone org.linphoneFirst release: Dec 18, 2025
Linthra io.github.thezupzup.linthraOpen-source, local-first music player for music you own. No forced sync.
First release: Aug 3, 2026
Linux Command Library com.inspiredandroid.linuxcommandbibliothecaFirst release: Sep 21, 2025
LinxShare com.kolktech.linxshareShare images on your device with others through your self-hosted linx server
First release: Oct 18, 2025
Liquid Wars OS com.xenris.liquidwarsosFirst release: Oct 1, 2024
Li-Ri org.liri.liriLi-Ri is a arcade game where you drive a toy wood engine.
First release: Dec 24, 2025
Liseur com.chmouel.liseurEPUBs: AI, read-aloud, translation, character guides and automatic mind maps.
First release: Aug 12, 2026
Lissen org.grakovne.lissenFirst release: Sep 23, 2025
ListenBrainz org.listenbrainz.androidFirst release: Feb 5, 2026
- LISTEN.moe me.echeung.moemoekyun
First release: Nov 9, 2025
LISTEN.moe me.echeung.moemoekyun.fdroidFirst release: Oct 8, 2026
Literal Launcher fumi.day.literallauncherFirst release: Aug 18, 2026
Literal Memo fumi.day.literalmemoFirst release: Aug 5, 2026
- Lithuanian for AnySoftKeyboard org.herrlado.ask.languagepack.lithuanian
First release: Jul 31, 2026
- Little File Explorer com.martinmimigames.simplefileexplorer
First release: Apr 17, 2025
- Little Painter io.github.marietetbc.littlepainter
First release: Jul 31, 2026
Little Relay app.umerfarooq.littlerelayBidirectional data bridge between BLE and an MQTT broker
First release: Feb 9, 2026
Litube com.hhst.litubeAn advanced WebView wrapper for YouTube
First release: Jan 27, 2026
LiveGG1 com.jstone.livegalgameFirst release: Dec 3, 2025
LiveTempo it.livetempo.appManage song playlists with BPM references for live performances
First release: Oct 13, 2026
- Live Wallpaper Dino game com.example.livewallpaperdinogame
First release: Aug 2, 2026
- Live Wallpaper Dino game com.helloworld3003.livewallpaperdinogame
First release: Jul 31, 2026
Livine com.mazen.livineFocuses on becoming healthy without any type of medication
First release: Feb 11, 2024
LMd de.monde_diplomatique.android.app.freeFirst release: May 24, 2025
- LN Address to Invoice ua.com.radiokot.lnaddr2invoice
First release: Jul 11, 2025
LNCTU Attendance com.meow.lnctattendanceTrack classes and view timetable statistics
First release: Oct 8, 2026
LNReader com.rajarsheechatterjee.LNReaderFirst release: Jan 28, 2024
- LoanPro net.kaltner.LoanPro
First release: Jul 31, 2026
Loc xyz.abdeltwab.locFirst release: Sep 25, 2026
- LocalCrop xyz.cmcdaniel.localcrop
First release: Jul 31, 2026
- Local Desktop app.polarbear
First release: Aug 5, 2026
Local Desktop io.github.localdesktopFirst release: Nov 1, 2026
LocalMathy dev.micr0.localmathySolve math problems fully offline with an on-device AI reasoning model
First release: Oct 8, 2026
- Local NLP Backend helium314.localbackend
First release: Jul 25, 2025
localplayer com.cvc953.localplayerFirst release: Oct 2, 2026
LocalSend Kotlin io.github.mouse233.localsendkotlinAn unofficial, lightweight Kotlin LocalSend client for older Android devices.
First release: Sep 9, 2026
LocalShare com.defname.localshareFirst release: Aug 9, 2026
- LocalTube org.schabi.newpipe.localserver
First release: Aug 2, 2026
- LockLock nethical.locklock
First release: Aug 2, 2025
- LockQR net.uniquecomputer.lockqr
First release: Oct 3, 2023
LocReminder com.zaifears.locreminderReminds you at the right place
First release: Sep 17, 2026
- Logcat com.tananaev.logcat
First release: Jul 2, 2025
Logcat Reader com.dp.logcatappFirst release: Oct 25, 2025
LogFox com.f0x1d.logfoxFirst release: Feb 8, 2026
Logger com.logger.appTrack, Analyze, and Manage Your Calls
First release: May 10, 2025
Logical Defence za.co.lukestonehm.logicaldefenceEncyclopedia of logical fallacies
First release: Apr 17, 2025
Logline com.patch4code.loglineAn Android Open Source Movie App
First release: Feb 1, 2026
Logseq com.logseq.appA privacy-first, open-source platform for knowledge management and collaboration
First release: Sep 18, 2025
LoliSnatcher com.noaisu.loliSnatcherFirst release: Jul 10, 2025
LoloTrans de.lolo.lolotransFirst release: Oct 8, 2026
London Transport dev.davidv.londontransportShows transport (Tube, Bus, Cycle) in London
First release: Oct 11, 2026
Look4Sat com.rtbishop.look4satSatellite tracker and pass predictor for Android
First release: Feb 10, 2026
- Loophole com.shubhang.loophole
First release: Aug 17, 2026
Loque com.innomatic.loqueappFirst release: May 26, 2024
Lotus com.dn0ne.lotusMusic player designed with Material You
First release: Jan 25, 2025
Lotus com.dn0ne.lotus.communityMusic player designed with Material You
First release: Aug 15, 2026
Loud Bang aq.metallists.loudbangRX/TX capable WSPR client
First release: Dec 21, 2025
- LoveLaceAV org.axpos.lovelaceav
First release: Jun 23, 2025
Lplanner (F-Droid) com.landerlab.lplanner.fdroidFirst release: Sep 15, 2026
- LRC Editor com.cg.lrceditor
First release: Feb 4, 2026
Lrc-R com.resurrect.lrc_rRead the rhythm.
First release: Sep 12, 2026
- LSPatch org.lsposed.lspatch
First release: Nov 23, 2023
- Ltt.rs rs.ltt.android
First release: Apr 13, 2025
LTvLauncher com.leanbitlab.ltvLFirst release: Jul 30, 2026
Luanti net.minetest.minetestVoxel-based multiplayer game platform
First release: Aug 1, 2025
LuCI Mobile com.cogwheel.LuCIMobileManage your OpenWrt router from your phone.
First release: Aug 29, 2025
Ludo com.sidhant.ludoMultiplayer Board Game
First release: Sep 15, 2026
- Ludo org.secuso.privacyfriendlyludo
First release: Jul 14, 2025
Lumi com.omardotdev.lumiFirst release: Nov 16, 2025
Lumine com.moi.lumineA lightweight local HTTP/SOCKS5 proxy server protects TLS connections over TCP.
First release: Sep 5, 2026
Lumo me.proton.android.lumoA private AI assistant by Proton
First release: Dec 1, 2025
Lumolight com.bitmavrick.lumolightSimple, modern & easy-to-use flashlight app that comes with a ton of features.
First release: Jun 18, 2025
- LunaChron io.github.garemat.lunachron
First release: Jul 31, 2026
- Lunar Launcher rasel.lunar.launcher
First release: Mar 12, 2024
LunaTracker it.danieleverducci.lunatrackerLunaTracker is a newborn baby tracking app.
First release: Oct 15, 2026
Luncher com.luncher.launcherAn offline, lightweight, customizable Android TV launcher that starts instantly.
First release: Oct 14, 2026
Lune com.demonlab.luneModern open source local music player for Android
First release: Aug 12, 2026
Luteal fr.luteal.appPrivate, offline-first cycle tracker separating facts from estimates
First release: Aug 26, 2026
Lux Alarm com.dsalmun.luxalarmWake up with light! This alarm can only be turned off when your room is bright
First release: Feb 9, 2026
- Luxembourgish for AnySoftKeyboard com.anysoftkeyboard.languagepack.luxembourgish
First release: Jul 31, 2026
- lWS QR net.basov.lws.qr.fdroid
First release: Aug 15, 2024
LxReader io.gitlab.coolreader_ng.lxreader.fdroidFirst release: Oct 8, 2026
LxReader io.gitlab.coolreader_ng.lxreader.fullE-book reader
First release: Nov 6, 2025
- Lyricistant com.wardellbagby.lyricistant
First release: Jan 15, 2025
- Lyrics sexy.lyrics
First release: Sep 22, 2025
Lyrics Grabbr com.illusionman1212.lyricsgrabbrFirst release: Aug 31, 2024
- Lyrion com.craigd.lmsmaterial.app
First release: Feb 1, 2026
Lyrion Dashboard com.werdeil.lyriondashboardNow-playing dashboard with synced lyrics for Lyrion Music Server
First release: Aug 12, 2026
M3Play com.j.m3playFirst release: Oct 8, 2026
maCat com.ahad.macatFirst release: Aug 21, 2026
MAC Editor io.github.jqssun.maceditorSecurely edit Wi-Fi MAC address on Android.
First release: Oct 22, 2026
- MACsposed com.berdik.macsposed
First release: Aug 17, 2026
- Mafia com.github.iamrezamousavi.mafia
First release: Jul 24, 2025
Mage dev.mage.ageFirst release: Aug 1, 2026
Mages org.mlm.magesExperimental Matrix client made using Compose Multiplatform (and Rust).
First release: Feb 9, 2026
Magisk com.topjohnwu.magiskThe Magic Mask
First release: May 14, 2025
Magnifica com.jarsilio.android.magnificaA magnificent magnifier
First release: Aug 4, 2026
- Magpie io.github.munzzyy.magpie
Tamper-evident incident journal with encrypted, self-proving exports
First release: Sep 14, 2026
Mahjong com.sidhant.mahjongClassic tile-matching puzzles without interruptions, tracking, or ads.
First release: Aug 4, 2026
mahjongscore com.kylefreed.mahjongscoreFirst release: Sep 15, 2026
Mahjong Solitaire com.vortessence.mahjongA performance-oriented classic Mahjong Solitaire game.
First release: Oct 14, 2026
MahsaNG com.MahsaNet.MahsaNGFirst release: Aug 22, 2025
- maid com.danemadsen.maid
First release: Apr 25, 2025
MainTask com.kapoue.maintaskReminders for your recurring tasks: filters, plants, backups, car checks…
First release: Oct 14, 2026
- MainTask com.maintask.app
First release: Aug 3, 2026
MakeACopy de.schliweb.makeacopyPrivacy-focused document scanner with OCR and PDF export
First release: Sep 24, 2025
- MakeACopy de.schliweb.makeacopy.light
First release: Feb 15, 2026
- MakeACopy Latin Best de.schliweb.makeacopy.lang.latin.best
First release: Oct 4, 2025
Mako com.rama.makoPrivacy-first Android launcher designed for focus, speed, and simplicity.
First release: Jan 12, 2026
- Malarm com.malarm
First release: Aug 11, 2026
- M.A.L.P. org.gateshipone.malp
First release: Jul 6, 2024
- Mancala com.willie.mancala
First release: Feb 13, 2025
- Mandarin com.tomclaw.mandarin
First release: Oct 9, 2023
Mangayomi com.kodjodevf.mangayomiFirst release: Aug 29, 2025
Manholer com.appaparilla.manholerFirst release: Aug 12, 2026
- ManhoodOfHumanity com.timebinding.manhoodofhumanity
First release: Mar 16, 2024
MapComplete org.mapcompleteThematic, editable maps based on OpenStreetMap
First release: Aug 23, 2026
MapFlip de.goork.mapflipOpen links in navigation apps: automatic map redirect, route & directions.
First release: Sep 19, 2026
Mapple com.pluscubed.am2geo.fossOpen Apple Maps links in your default maps app
First release: Oct 8, 2026
- Maps Geofavorites it.danieleverducci.nextcloudmaps
First release: Mar 1, 2024
MapSwipe org.missingmaps.mapswipeFirst release: Jan 13, 2026
maripànaTokana orinasa.njarasoa.maripanatokanaWeather app showing metric and imperial units side by side in 8 languages
First release: Aug 10, 2026
Markdown Editor com.adeeteya.markdown_editorMarkdown Editor is an app for easy editing and styling of ".md" files.
First release: Oct 12, 2025
markdownr com.sanzoghenzo.markdownrFirst release: Nov 5, 2023
MarketMonk com.codesail.market_monkFirst release: Mar 7, 2025
Markleaf com.markleaf.notesLocal-first Markdown notes with tags, search, and file export
First release: Jul 27, 2026
Markor net.gsantner.markorText editor - Notes & ToDo. Lightweight. Markdown and todo.txt support.
First release: Sep 20, 2025
MarkReader com.markreaderOffline markdown, notes, and code reader with syntax highlighting
First release: Aug 5, 2026
Marlin com.marlinid.marlinFirst release: Aug 10, 2026
Marmalade STT app.marmalade.sttPrivate, offline speech-to-text for your keyboard. Your voice stays on device.
First release: Oct 17, 2026
Marmalade TTS app.marmalade.ttsFast, natural, private text-to-speech for your whole phone. Works offline.
First release: Sep 3, 2026
MarschRide de.box2code.marschrideFirst release: Apr 6, 2024
Martial Body com.robinroy.martial_bodyFirst release: Oct 8, 2026
Maskan app.maskan.chatPrivate BYOK AI chat. 11 providers, voice, image, export. 3 languages.
First release: Aug 13, 2026
Mastodon org.joinmastodon.androidFirst release: Aug 22, 2025
Mastodon Redirect dev.zwander.mastodonredirectFirst release: Oct 8, 2026
Match 3 com.sidhant.match3Minimal and open-source Match-3 puzzle game
First release: Aug 13, 2026
MateDroid com.matedroidFirst release: Feb 11, 2026
Material Files me.zhanghai.android.filesOpen source Material Design file manager
First release: Jun 30, 2024
Materialious us.materialio.appModern material design for YouTube and Invidious.
First release: Feb 13, 2026
- Materialistic Nouveau com.growse.android.io.github.hidroh.materialistic
First release: Aug 30, 2026
Materializr com.materializr.appMaker 3D CAD - the middle ground between Tinkercad and FreeCAD
First release: Aug 3, 2026
Material Notes com.maelchiotti.localmaterialnotesSimple, local, material design notes
First release: Nov 7, 2025
Material Photo Widget com.fibelatti.photowidgetFirst release: Jan 21, 2026
- Materials Live Wallpaper com.reminimalism.materialslivewallpaper
First release: Nov 8, 2025
Math Clock com.mathclockWidget, which shows the time in German words based on fractions
First release: Sep 9, 2026
Mathe-Trainer com.chrbayer.mathe_trainerMental arithmetic practice for primary school. German interface.
First release: Oct 1, 2026
matoid de.box2code.matoidFirst release: Apr 22, 2024
Matrix Puzzle com.sidhant.matrixpuzzleA minimal, open-source matrix puzzle game also known as floor puzzle
First release: Aug 26, 2026
Matrix Synapse Manager com.matrix.synapse.managerFirst release: Oct 8, 2026
MatrixTinz com.goodify.matrixtinz.appFirst release: Aug 8, 2026
Mattermost Beta com.mattermost.rnbetaSecure, self-hosted workplace messaging
First release: Mar 17, 2026
Mauth com.xinto.mauthA Beautiful Two-factor Authentication app.
First release: Sep 18, 2025
- MAXS Main org.projectmaxs.main
First release: Jan 22, 2025
- MAXS Module AlarmSet org.projectmaxs.module.alarmset
First release: Jul 31, 2026
- MAXS Module Bluetooth org.projectmaxs.module.bluetooth
First release: Jul 31, 2026
- MAXS Module BluetoothAdmin org.projectmaxs.module.bluetoothadmin
First release: Jul 31, 2026
- MAXS Module Clipboard org.projectmaxs.module.clipboard
First release: Jul 31, 2026
- MAXS Module ContactsRead org.projectmaxs.module.contactsread
First release: Jul 31, 2026
- MAXS Module FileRead org.projectmaxs.module.fileread
First release: Jul 31, 2026
- MAXS Module FileWrite org.projectmaxs.module.filewrite
First release: Jul 31, 2026
- MAXS Module LocationFine org.projectmaxs.module.locationfine
First release: Jul 31, 2026
- MAXS Module Misc org.projectmaxs.module.misc
First release: Jul 31, 2026
- MAXS Module NFC org.projectmaxs.module.nfc
First release: Jul 31, 2026
- MAXS Module Notification org.projectmaxs.module.notification
First release: Jul 31, 2026
- MAXS Module PhonestateRead org.projectmaxs.module.phonestateread
First release: Jul 31, 2026
- MAXS Module Ringermode org.projectmaxs.module.ringermode
First release: Jul 31, 2026
- MAXS Module Shell org.projectmaxs.module.shell
First release: Jul 31, 2026
- MAXS Module SmsNotify org.projectmaxs.module.smsnotify
First release: Jul 31, 2026
- MAXS Module SmsRead org.projectmaxs.module.smsread
First release: Jul 31, 2026
- MAXS Module SmsSend org.projectmaxs.module.smssend
First release: Jul 31, 2026
- MAXS Module SmsWrite org.projectmaxs.module.smswrite
First release: Jul 31, 2026
- MAXS Module WifiAccess org.projectmaxs.module.wifiaccess
First release: Jul 31, 2026
- MAXS Module WifiChange org.projectmaxs.module.wifichange
First release: Jul 31, 2026
- MAXS Transport XMPP org.projectmaxs.transport.xmpp
First release: Jul 31, 2026
MBCompass com.mubarak.mbcompassCompass, GPS tracker & offline maps. No ads, no tracking.
First release: Sep 5, 2025
- これMD(マジ)? com.pyu.koremd
First release: Feb 11, 2026
MDM Agent com.hmdm.launcherMobile Device Management (MDM) System for Android (mobile agent - launcher)
First release: Feb 3, 2026
Mealient gq.kirmanak.mealientUnofficial client for the self-hosted recipe manager Mealie.
First release: Aug 4, 2024
- Meaningless Keyboard com.miyabi_hiroshi.app.meaninglesskeyboard
First release: Feb 18, 2026
- Media Browser com.sergenious.mediabrowser
First release: Aug 13, 2024
Media Collection net.forestany.mediacollectionCatalog your movie and series collection - fast, simple, offline.
First release: Aug 24, 2025
Medical Calendar Log de.ntdote.medicalcalendarlogPrivacy-focused medical event tracking using your device's calendar system
First release: Jan 22, 2026
- MedicLog org.paladyn.mediclog
First release: Feb 1, 2026
Medic Log m.co.rh.id.a_medic_logA simple and easy to use personal medical notes
First release: Jan 17, 2026
MediLog com.zell_mbc.medilogLog health metrics such as blood pressure, weight and quite a few others
First release: Oct 8, 2026
- MediLog com.zell_mbc.medilog.fdroid
First release: Feb 6, 2026
- MediNote lk.dulanjaya.medinote
First release: Mar 17, 2025
Meditate io.github.janekbt.MeditateMeditation timer with session log, stats, and Nextcloud sync
First release: Aug 23, 2026
- Meditation com.nyxkn.meditation
First release: Dec 6, 2024
- Meditation Assistant sh.ftp.rocketninelabs.meditationassistant.opensource
First release: Oct 20, 2024
Meditation Timer com.exner.tools.meditationtimerApp that counts, beeps, and helps with repeating tasks, such as meditation.
First release: May 3, 2025
- Meditation Timer com.wordpress.brunoloff.meditationtimer
First release: Jul 31, 2026
MediTrak projects.medicationtrackerFirst release: Feb 11, 2026
Medkit ru.application.homemedkitHome Medkit — medicine storage and intake reminders.
First release: Jan 21, 2026
MedTimer com.futsch1.medtimerFirst release: Sep 18, 2025
- MeeRoo de.synyx.android.meetingroom
First release: Nov 13, 2025
- Megalodon org.joinmastodon.android.sk
First release: Nov 15, 2023
MegaProxy net.megaproxy487VPN with HTTPS/SSH jump hosts, SOCKS5, MASQUE and split tunneling
First release: Oct 12, 2026
Megrim org.maegley.megrimPrivate, offline migraine log with automatic on-device pattern insights.
First release: Aug 26, 2026
- meine Gleitzeit de.leverbursche.meinegleitzeitapp
First release: Aug 11, 2026
Melodeon org.billthefarmer.melodeonMelodeon emulator
First release: Aug 19, 2022
Melotune com.harsh.shah.saavnmp3First release: Dec 2, 2025
MemeBoard com.bluefirestudios.memeboardA goofy ahh meme soundboard app for Android.
First release: Oct 8, 2026
- Memento de.mwarning.memento
First release: Apr 20, 2025
Memerize app.suhasdissa.memerizeFirst release: Aug 1, 2026
- Memo Game org.secuso.privacyfriendlymemory
First release: Jul 23, 2025
- Memories gallery.memories
First release: Jan 26, 2026
- Memory com.sanskritbasics.memory
First release: Dec 28, 2020
MemoryGuardian ara.memoryguardianTake Control of Your Clipboard
First release: Nov 16, 2024
Mempal com.example.mempalA Bitcoin mempool monitoring and notification app for Android.
First release: May 17, 2025
- Mensa-Guthaben de.yazo_games.mensaguthaben
First release: Jul 26, 2024
- MensaZH ch.famoser.mensa
First release: Nov 13, 2025
mensen de.ciluvien.mensenAccess the menu of Dresden's canteens.
First release: Jan 29, 2026
Mensinator com.mensinator.appTailored Period Tracking, Total Privacy—Your Period, Your Control.
First release: Mar 29, 2025
- Mental Math 101 com.helddertierwelt.mentalmath101
First release: Feb 24, 2026
- Menu Generator io.menu_generator
First release: Oct 29, 2024
Menza cz.lastaapps.menzaDish menus from CTU cafeterias, offers a modern UI and functionality.
First release: Sep 28, 2025
Mercurygram it.belloworld.mercurygramTelegram is a messaging app with a focus on speed and security.
First release: Sep 12, 2024
- Mercurygram Tor Plugin it.belloworld.mercurygram.plugin.tor
Tor companion plugin that routes Mercurygram traffic through the Tor network
First release: Aug 23, 2026
- MergedWiFiNLP info.spotcomms.wlanbackend
First release: Dec 9, 2024
Meron jp.nonbili.meronMail app that sparks joy
First release: Sep 7, 2026
Mesh+ com.borodutch.meshplusChat over Meshtastic radios with no internet or cell service. Simple, private.
First release: Oct 16, 2026
MESH com.barghest.meshCensorship-resisting overlay network for digital forensics
First release: Sep 17, 2026
MeshCore Open com.meshcore.meshcore_openFirst release: Oct 12, 2026
- MeshCore Signal Tester cz.kyblsoft.meshcore.signaltester
First release: Sep 27, 2026
Meshenger d.d.meshengerFirst release: Aug 7, 2025
Meshtastic com.geeksville.meshFirst release: Jul 7, 2025
Message487 life.andre.message487Read phone SMS on your computer via n8n; forward selected notifications
First release: Sep 15, 2026
- Messages com.anindra.messages
Simple, private SMS messaging. Offline-first, no ads, no tracking.
First release: Sep 9, 2026
- Messages org.fossify.messages
First release: Sep 9, 2025
Messages org.prauga.messagesA fast messaging app designed to make conversations simple and effortless
First release: Jan 26, 2026
Metadata Remover rocks.poopjournal.metadataremoverProtect your privacy by removing metadata from your photos, videos and documents!
First release: Aug 4, 2024
MetaGer de.metager.metagerapp.fdroidAnonymous search and tab groups, private browsing with tracker and ad blocking.
First release: Jan 13, 2025
- MetaGer de.metager.metagerapp.manual
Anonymous search and tab groups, private browsing with tracker and ad blocking.
First release: Aug 4, 2026
Metager Maps de.metager.maps.manualKort-app baseret på Openstreetmap. Ruteplanlægger - Navigation
First release: Aug 29, 2025
MetaMask io.metamaskFirst release: Jun 12, 2026
MetaPurge com.metapurge.appLocally strip sensitive EXIF/metadata from your photos.
First release: Oct 8, 2026
MeteoCompare com.meteocompare.appCompare 21 weather models, 10-day forecasts, local alerts and detailed charts.
First release: Sep 26, 2026
Meteo Weather Greece com.vitabytes.meteoweathergrFirst release: Mar 28, 2024
- meteroid de.chaosdorf.meteroid
First release: Jun 12, 2025
Method Call com.coleblvck.methodcallAutomate your phone calls.
First release: Dec 16, 2024
Metiq xyz.metiqColored noise, binaural beats & ambient sounds for sleep, study and focus.
First release: Jul 29, 2026
- Metrodroid au.id.micolous.farebot
First release: Nov 14, 2025
Metrolist com.metrolist.musicMaterial 3 YouTube Music client for Android
First release: Sep 25, 2025
MetroMusic com.metromusicA music player in the Windows Phone 8 idiom, for the music on your phone.
First release: Aug 3, 2026
Metronome com.bobek.metronomeA simple and elegant metronome
First release: Oct 6, 2025
- Metronome de.moekadu.metronome
First release: Jul 18, 2025
Metronome de.moekadu.metronomenextMetronome app for playing repeated rhythms at different speeds.
First release: Nov 11, 2025
Metro Vault com.gorunjinian.metrovaultAir-gapped Bitcoin signer for offline cold storage. QR-only, no network.
First release: Aug 4, 2026
MFC Balance de.drmaxnix.mfcbalanceFirst release: Oct 8, 2026
- MHWorld Database com.gatheringhallstudios.mhworlddatabase
First release: Sep 24, 2025
- microG Services com.google.android.gms
First release: Feb 9, 2026
- microMathematics Plus com.mkulesh.micromath.plus
First release: Apr 13, 2024
Microphone net.bitplane.android.microphoneFirst release: Jan 7, 2026
- Micro REPL micro.repl.ma7moud3ly
First release: May 16, 2025
- Micro Timer dubrowgn.microtimer
First release: Feb 18, 2024
- Midandpad org.gnu.itsmoroto.midandpad
First release: Dec 2, 2024
Middor org.nktnet.middorMirror applications for HUD display with horizontal flip.
First release: Feb 6, 2026
midistrum com.gnethomelinux.midistrumFirst release: Oct 8, 2026
- Midnight com.kaz.midnight
First release: Jul 31, 2026
- MIFARE Classic Tool de.syss.MifareClassicTool
First release: Jan 25, 2026
- Mightier Amp com.tuntori.mightieramp
First release: Jul 23, 2024
Migraine Log org.zerodogg.migraineLogFirst release: Jan 2, 2026
Migu watch.miguFirst release: Feb 24, 2025
- Mihon app.mihon
First release: Aug 7, 2025
Mihrab com.prayer_timesPrayer times matching Diyanet, Kemenag & more to the minute. Quran, dua, qibla.
First release: Aug 4, 2026
MileLog com.milelogMileage, expense and revenue tracker for self-employed drivers
First release: Oct 9, 2026
- Milki Launcher com.milki.launcher
First release: Aug 8, 2026
Mill com.calcitem.sanmillA Mill Game which supports many rule variants, written in Flutter
First release: Oct 19, 2024
MinCal Widget cat.mvmike.minimalcalendarwidgetFirst release: Sep 9, 2025
Mindful com.mindful.androidFirst release: Aug 16, 2025
- Mindful Attention Awareness Scale biz.binarysolutions.mindfulscale
First release: Jul 7, 2025
- Mindfulness Meditation biz.binarysolutions.mindfulnessmeditation
First release: Jul 9, 2025
Mindfulness Reminder com.theissenmatthias.mindfulness_reminderMindfulness reminders for everyday life
First release: Oct 8, 2026
Mindustry io.anuke.mindustryAn open-ended factory management game with RTS and tower defense elements
First release: Feb 18, 2026
Mindwtr tech.dongdongbh.mindwtrClear your head: capture tasks fast, see your next step. Offline, free, GTD.
First release: Jul 28, 2026
- Mines3D cos.premy.mines
First release: Feb 9, 2025
- Minesweeper com.joeld.minesweeper
First release: Aug 4, 2026
Minesweeper io.github.johnathan.minesweeperBeautiful Minesweeper. No ads, no trackers, no permissions.
First release: Sep 11, 2026
- Minesweeper org.secuso.privacyfriendlyminesweeper
First release: Sep 19, 2025
Miniflutt be.martinelli.minifluttFirst release: Nov 11, 2025
- Minimal Currency Converter com.simonimal.minimalcurconv
First release: Sep 18, 2025
- MinimaList ca.toadlybroodle.minimalist
First release: Jul 31, 2026
Minimo Launcher com.minimo.launcherFirst release: Sep 14, 2025
Minimum juniojsv.minimumFirst release: Mar 9, 2025
Minis companion com.cdevaux.miniature_painting_companionFirst release: Jan 9, 2026
Miniter org.mlm.miniterVideo editor built for simple tasks
First release: Sep 16, 2026
MinkLauncher OpenSource com.katoaapps.openminilaunchA minimal, keyboard-first Android home-screen launcher
First release: Aug 16, 2026
- MinLauncher io.github.ouj4k2q5.minlauncher
First release: Sep 23, 2026
Mint me.sanao1006.mint.releaseFirst release: May 4, 2025
Min Time com.thomaskuenneth.mintimeA minimalistic talk timer to help structure your talks and presentations.
First release: Jan 13, 2026
Minus com.serranoie.app.minusFirst release: Jul 31, 2026
- Minute Maze net.ygingras.minutemaze
First release: Feb 20, 2025
Miroji com.rogeriodocarmo.mirojiFirst release: Aug 4, 2026
Mirror com.polar.mirrorSimple Android application turning your device into a pocket mirror🪞
First release: Mar 30, 2024
Mirror fr.hellpc.mirrorMultiprotocol backup application (NFS, SMB, FTP, SFTP, WebDAV)
First release: Aug 16, 2026
Mirror io.github.jqssun.displaymirrorScreen mirroring manager with support for AirPlay, Moonlight, and DisplayLink.
First release: Jul 26, 2026
Miru miru.miaomintFirst release: Jan 19, 2024
Misga com.miss.gaSmart SMS app with regex filters to eliminate spam in Iran
First release: Nov 2, 2026
Mission com.axelblatt.missionFirst release: Aug 13, 2025
- Misty Breez com.breez.misty
First release: Aug 25, 2025
- Mitch ua.gardenapple.itchupdater
First release: Nov 26, 2024
- Mixer Controller com.yozachar.apps.soundcraftmixer
First release: May 23, 2024
- MKM com.ivarna.mkm
First release: Jul 31, 2026
- MMRL com.dergoogler.mmrl
First release: Dec 21, 2025
- Mnemosyne com.zarathustra.mnemosyne
First release: Feb 26, 2025
- MoasdaWiki net.moasdawiki.app
First release: Jan 3, 2026
- mobapp-game io.github.vipaol.mobapp.game
First release: Jul 31, 2026
Mobile Harness com.jarves.mhAI coding, Linux terminal, files, diffs, and previews on Android
First release: Sep 29, 2026
Mobile Maia com.dash1971.maia_chessOffline chess against Maia-3 with local Stockfish analysis
First release: Sep 20, 2026
Mobile Paper Wallet com.gitlab.uak.mobile_paper_walletCreate single use cryptocurrency wallet, just like a paper wallet
First release: Aug 23, 2026
- Mobile Tile Server com.bojko108.mobiletileserver
First release: Jun 8, 2025
- MobiloSignal barilyuk.mobilosignal
First release: Jul 31, 2026
- Mock my GPS com.github.warren_bank.mock_location
First release: Sep 14, 2024
- Mock my GPS UnifiedNlp Backend com.github.warren_bank.mock_location.service.microg_nlp_backend
First release: Jul 31, 2026
- Mock Silently com.github.warren_bank.mock_location.silently
First release: Jul 31, 2026
- MockTraffic com.nemesis.mocktraffic
First release: Oct 20, 2024
Modern T9 io.github.jcastell7.modernt9Predictive T9 keyboard with no network access and no telemetry
First release: Oct 2, 2026
MoeList com.axiel7.moelistFirst release: Jun 13, 2025
MoeMemos me.mudkip.moememosAn app to help you capture thoughts & ideas
First release: Feb 15, 2026
- MoldQueen io.github.jrichter24.moldqueen
First release: Jul 31, 2026
- MoLe net.ktnx.mobileledger
First release: Aug 4, 2026
Momentum shub39.momentumApp to make Montages easily
First release: Sep 1, 2026
Mona com.deliacheminot.monaFirst release: Aug 3, 2026
- Mondstern Acrylic Icons de.moooon.acrylicons
First release: Dec 14, 2025
monerujo com.m2049r.xmrwalletFirst release: Jun 17, 2025
MoneyBuster net.eneiluj.moneybusterMulti-project shared budget manager able to sync with self hosted FOSS services
First release: Aug 15, 2024
Money Manager Ex com.money.manager.exFirst release: Sep 20, 2025
- Money Manager Ex com.money.manager.ex.android
First release: Aug 26, 2026
- Money Manager Ex (Cloud version) com.money.manager.ex.synccloud
First release: Jun 2, 2026
- Moneytopia com.dimrnhhh.moneytopia
First release: Nov 9, 2024
- Money Tracker com.blogspot.e_kanivets.moneytracker
First release: Aug 3, 2026
Monfluo org.monfluo.wallet.betaA pure Monero wallet
First release: Aug 4, 2026
Monica takagi.ru.monica.fdroidOpen-source password manager: local encryption, autofill, TOTP, Passkey
First release: Sep 7, 2026
- Monly org.asafonov.monly
First release: Jan 10, 2025
- monocles browser de.monocles.browser
First release: Jul 31, 2026
- monocles browser de.monocles.browser.standard
First release: Aug 16, 2025
- monocles chat de.monocles.chat
First release: Feb 6, 2026
- Monocons k4ustu3h.monocons
First release: Aug 1, 2026
Monocons k4ustu3h.monocons.izzyFirst release: Aug 1, 2026
MonsterMusic com.ztftrue.musicFirst release: Sep 14, 2025
Mood Cairns com.lcdcode.moodcairnsPrivate, fully offline mood tracker with tags and charts. No network access.
First release: Sep 23, 2026
MoodyRoutine com.ndev.moodyroutineSamsung One UI-style Modes and Routines automation engine for Android.
First release: Oct 15, 2026
Mooneva Cycle com.mooneva.appPrivate period & cycle tracker. Offline, encrypted, no account, no ads.
First release: Aug 10, 2026
- Moonlight com.limelight
First release: Feb 28, 2024
- MorbidMeter org.epstudios.morbidmeter
First release: May 6, 2025
- moreDays de.wuapps.moredays
First release: Nov 2, 2024
MOROway de.moroway.ocPlay with the MORO model railroad…
First release: Feb 10, 2026
MorphCook de.themorpheus.morphcookevery diet gets the whole cookbook. vegan döner included. works offline.
First release: Sep 11, 2026
- Morse rocks.poopjournal.morse
First release: Oct 2, 2025
- Moshidon org.joinmastodon.android.moshinda
First release: Jun 14, 2025
moStard org.mostardFirst release: Oct 8, 2026
motd io.github.trevarj.motdNative IRC chat with history, themes, soju and ZNC support
First release: Aug 10, 2026
- Motion cues dev.davidv.motionsickness
First release: Oct 8, 2026
MotionEaseTune com.bhznjns.motion_ease_tuneA simple application that can prevent you from motion sickness via 100Hz sound.
First release: May 29, 2025
- Motion Eye com.jairaj.janglegmail.motioneye
First release: Jul 20, 2025
- MotionLock us.spotco.motionlock
First release: Dec 9, 2024
- Motion-UI app.motionui.android
First release: Jan 19, 2026
MotivationalApp com.takasu.motivational_app.directFirst release: Oct 8, 2026
- mOTP org.cry.otp
First release: Oct 13, 2024
- Mousedroid com.darusc.mousedroid
First release: Jul 20, 2025
MoveAPiece de.schliweb.moveapieceOffline chess vs Stockfish or Maia, opening trainer, Pegasus & Chessnut boards
First release: Oct 2, 2026
MovieFlix com.shalenmathew.movieflixCinephile's Movie Diary
First release: Jan 17, 2026
Moviesy com.kpstv.ytsFirst release: Dec 26, 2022
MPD org.musicpdFirst release: Feb 1, 2025
mpv is.xyz.mpvLightweight video player based on libmpv
First release: Aug 25, 2025
mpvEx app.marlboroadvance.mpvexFirst release: Jan 24, 2026
- mpvEx app.marlboroadvance.mpvex.preview
First release: Jan 19, 2026
mpvKt live.mehiz.mpvktA media player based on the popular commandline media player mpv.
First release: Sep 14, 2024
- MqttDroid lightjockey.mqttdroid
First release: May 18, 2024
mqvpn org.mqvpn.appMultipath VPN combining Wi-Fi and cellular for bonding and failover
First release: Aug 26, 2026
MRMCD 2026 Schedule info.metadude.android.mrmcd.scheduleFirst release: Sep 5, 2026
- MRT Buddy net.adhikary.mrtbuddy
First release: Dec 10, 2024
- MsgGo top.yztz.msggo
First release: Jan 23, 2026
- MSM com.prinzpiuz.msm
First release: Dec 2, 2025
- MTG Familiar com.gelakinetic.mtgfam
First release: Apr 8, 2025
MTS Dialer cz.mts.phonePhone app (calling, blocking, contacts) that you’ll love !
First release: Sep 26, 2026
mTUO de.neuwirthinformatik.alexander.mtuoFirst release: May 3, 2024
mucke rocks.muckeA music player for local files with unique custom playback options.
First release: Nov 1, 2026
mucke rocks.mucke.githubFirst release: Aug 16, 2026
- Muezzin com.mehmetakiftutuncu.muezzin
First release: Oct 31, 2020
- Mule on Android org.dkf.jmule
First release: Sep 3, 2023
Multi Launcher app.mlauncherMulti Launcher ‧ Home Screen
First release: Sep 21, 2025
- Multi Launcher Nightly app.mlauncher.nightly
First release: Jan 19, 2026
- MultiLocale io.nightdavisao.multilocale
First release: Oct 28, 2024
- MultiVNC com.coboltforge.dontmind.multivnc
First release: Aug 26, 2025
Mumla se.lublin.mumlaVoice chat on Mumble servers
First release: Mar 16, 2026
MuPDF mini com.artifex.mupdf.mini.appFirst release: Feb 6, 2026
- MuPDF viewer com.artifex.mupdf.viewer.app
First release: Feb 6, 2026
Murem com.musicremover.appFirst release: Oct 8, 2026
Musekit com.kwasow.musekitFirst release: Feb 10, 2026
- Museum of a broken API godau.fynn.usagedirect.system
First release: Mar 30, 2024
- Mushotoku com.mushotoku.app
First release: Jul 31, 2026
- Music com.vayunmathur.music
First release: Jul 31, 2026
Music.axs dev.pgaxis.musicaxsFirst release: Jul 29, 2026
MusicBee Remote com.kelsos.mbrcFirst release: Sep 25, 2026
- Musicore io.github.mlm_games.musicore
First release: Oct 5, 2025
music player com.steel101.musicplayermusic player that auto pulls art work
First release: Sep 30, 2026
Music Player org.fossify.musicplayerFirst release: Sep 9, 2025
- Music Player Lite com.atul.musicplayer
First release: Apr 27, 2025
- MusicSearch io.github.lydavid.musicsearch
First release: Sep 23, 2025
Musify com.gokadzev.musifyFirst release: Aug 30, 2025
Musify com.gokadzev.musify.fdroidUnlock the full potential of music: Stream effortlessly with one app!
First release: Oct 12, 2026
- Musikus app.musikus
First release: Jan 17, 2025
- Mute reminder com.github.muellerma.mute_reminder
First release: Jul 19, 2025
Muzei net.nurik.roman.muzeiFirst release: Aug 13, 2025
- Muzei - Bing Image of the Day de.devmil.muzei.bingimageofthedayartsource
First release: Jul 24, 2025
- Muzei Legacy net.nurik.roman.muzei.legacy
First release: Aug 3, 2026
- Muzei Pixiv Source one.oktw.muzeipixivsource
First release: Mar 22, 2023
- Muzza com.maloy.muzza
First release: Feb 8, 2026
- My Brain com.mhss.app.mybrain
First release: Jun 7, 2025
Mycelium social.mycelium.androidFirst release: Mar 30, 2026
- My Diary com.sinxn.mydiary
First release: Oct 8, 2026
- My Expenses org.totschnig.myexpenses
First release: Dec 18, 2025
- MyFastingApp org.myfastingapp.app
First release: Oct 8, 2026
MyFin com.afaneca.myfinPersonal Finance Manager
First release: Oct 7, 2025
MyFinanceMate com.myfinancemateFirst release: Aug 5, 2026
- MyGarden fr.bugprogEnterprise.mygarden
First release: Mar 14, 2024
myGeo org.calantas.mygeoShare your Geo Location as Latitude and Longitude with your own template.
First release: Jul 11, 2025
- MyHackerspace io.spaceapi.community.myhackerspace
First release: Jul 6, 2025
- MyKanji io.github.hathibelagal.mykanji
First release: Jun 13, 2025
My Leaf dk.kjeldsen.carwingsflutterRemote control and information for your Nissan Leaf
First release: Oct 7, 2025
MyLexicon com.aryanyadav.mylexiconOffline-first personal dictionary and vocabulary companion.
First release: Sep 23, 2026
- My Location com.mirfatif.mylocation
First release: Dec 25, 2025
MyMood com.nima.mymoodSimple and minimalistic app to track your daily mood with.
First release: May 25, 2025
Myne com.starry.myneAndroid application to download & read ebooks from the Project GutenBerg.
First release: Sep 23, 2025
- My Notes com.aa.mynotes
First release: Aug 10, 2026
My Price Log app.zornslemma.mypricelogFirst release: Jan 14, 2026
My Sensor com.saionji.mysensorAir quality monitoring from public sensor.community data
First release: Oct 8, 2026
- MyShare net.chlup.myshare
First release: Aug 4, 2026
Mysterium Dark network.mysterium.vpnDecentralized VPN for Web 3: Anonymous, secure and unblocked internet
First release: Sep 15, 2025
- NadaMillas com.devbaltasarq.nadamillas
First release: Jul 2, 2025
Naija Ludo + com.mshdabiola.ludo.fossNaija Ludo: A Modern Twist on the Classic Board Game
First release: Feb 6, 2025
Nanna Baby Monitor org.vpilo.babymonitorBaby monitor to stream privately between your own phones and computers
First release: Oct 28, 2026
NanoLedger be.chvp.nanoledgerFirst release: Nov 15, 2025
- NASA APOD for Muzei com.example.muzei.muzeiapod
First release: Jul 21, 2025
NATINFo+ net.retiolus.natinfoAdvanced NATINF (NATure INFraction) search, offences under French law
First release: Feb 10, 2026
- National Geographic for Muzei de.msal.muzei.nationalgeographic
First release: Jan 20, 2024
Native Alpha com.cylonid.nativealphaNative Alpha: Full screen Web Apps with shortcuts and custom settings
First release: May 18, 2025
Navic paige.navicFirst release: Aug 26, 2026
- Navit org.navitproject.navit
First release: Aug 2, 2026
- NCarousel dev.nemeyes.ncarousel
First release: Aug 7, 2026
NC Collectives com.megamaced.nccollectivesUnofficial Android client for Nextcloud Collectives wiki notebooks.
First release: Jul 31, 2026
- NClientV2 com.dar.nclientv2
First release: Nov 19, 2023
NClientV3 com.yosefario.nclientv3A configurable manga client for Android. Fork of NClientV2.
First release: Oct 31, 2026
Nearby Glasses ch.pocketpc.nearbyglassesSmart Glasses are often hard to spot. This app scans for their Bluetooth ID.
First release: Mar 25, 2026
- Nearby Settings com.turtlepaw.nearby_settings
First release: Apr 27, 2025
NearNote com.cleannote.appOffline notes with location-based reminders, folders, and timeline
First release: Oct 12, 2026
- NeatLauncher de.theiling.neatlauncher
First release: Jul 4, 2025
- Nebula HDR com.jordanadema.nebula
First release: Jul 31, 2026
- Neer com.criticalay.neer
First release: Mar 17, 2024
- NeionLauncher neion.nlchr2
First release: Oct 1, 2026
NekoBox moe.nb4aFirst release: Sep 20, 2025
Nekogram tw.nekomimi.nekogramFirst release: Sep 4, 2025
- Nekome com.chesire.nekome
First release: Aug 18, 2024
- NekoSMS com.crossbowffs.nekosms
First release: Oct 14, 2023
NekoVideo com.nkls.nekovideoOpen-source local video player with folders, private content and DLNA cast
First release: Aug 4, 2026
Neo Backup com.machiav3lli.backupThe open-source tool to backup your apps and data
First release: Mar 22, 2025
NeoDB You day.vitayuzu.neodbFirst release: Sep 21, 2025
Neo Feed com.saulhdev.neofeedFirst release: Nov 9, 2025
Neon com.github.handewo.neonFirst release: May 21, 2025
Neo Store com.machiav3lli.fdroidA modern feature-rich F-Droid client.
First release: Sep 6, 2025
NeoStumbler xyz.malkki.neostumblerFirst release: Feb 12, 2026
NeoStumbler xyz.malkki.neostumbler.fdroidApplication for collecting wireless networks to geolocation services
First release: Oct 15, 2026
NER Cycle App io.github.benediktburger.cycleappLocal cycle evaluation per the NER rules (Rötzer) — data stays on device.
First release: Oct 22, 2026
NerdCalci com.vishaltelangre.nerdcalciCalculator for nerds with variables, syntax highlighting, and file sessions
First release: Jul 28, 2026
NerdSteam com.github.khanshoaib3.nerdsteamFirst release: Nov 30, 2025
Neruppu org.havenapp.neruppuFirst release: Oct 8, 2026
NetBird io.netbird.clientFirst release: Jan 26, 2026
- NetGuard eu.faircode.netguard
First release: Oct 12, 2025
- NetToggle com.dhangofa.networktoggle
First release: Aug 1, 2026
Network Scanner com.networkscanner.appWho's on my WiFi? Find every device, its IP address & open ports. No ads.
First release: Aug 1, 2026
Network Survey com.craxiom.networksurveyDisplays and Logs Cellular, Wi-Fi, Bluetooth, and GNSS Network Survey Details
First release: Jan 29, 2026
Network Survey+ com.craxiom.networksurveyplusFirst release: Oct 14, 2026
Network Switch com.supernova.networkswitchOne-tap network switching.
First release: Aug 23, 2025
Neumorphic Calculator com.ragheb.neumorphic_calculatorA sleek, customizable calculator with a soft, modern, neumorphic-inspired design.
First release: Jun 30, 2025
NeuroCalm nodomain.synapp.neurocalmVagus nerve stimulator for calm & relaxation using gentle ear vibration.
First release: Aug 1, 2025
Neuron Encrypt com.neuronencrypt.appLocal file encryption. No accounts. No internet. No compromise.
First release: Aug 10, 2026
neutriNote CE com.appmindlab.nanoA hub of written thoughts in fast searchable plain text
First release: Sep 20, 2025
NeverTooManyBooks com.hardbacknutter.nevertoomanybooksFirst release: Jan 23, 2026
NewPass com.gero.newpassSecurely store and manage passwords of your digital realm with NewPass.
First release: Jun 17, 2024
News de.luhmer.owncloudnewsreaderAndroid App for Nextcloud News App (requires own Nextcloud instance)
First release: Feb 16, 2025
- NewsBlur com.newsblur
First release: Aug 27, 2025
News Provider m.co.rh.id.a_news_providerA simple and easy to use RSS aggregator that deliver news to your smartphone
First release: Jan 17, 2026
- News Reader livio.rssreader
First release: Oct 18, 2025
NexNode com.swatian.nexnode.freeFirst release: Oct 8, 2026
- Nex Notes com.swatian.nexnotes
First release: Jul 3, 2025
Nexpill com.superdavelab.nexpillMedication reminders that arrive on time. No account, no internet.
First release: Oct 11, 2026
Next Actualités informatiques com.pcinpactCheck out french Next computer news (even without an Internet connection)!
First release: Aug 23, 2025
Nextcloud com.nextcloud.clientFirst release: Sep 10, 2025
- Nextcloud Cookbook de.micmun.android.nextcloudcookbook
First release: Feb 26, 2024
Nextcloud Deck it.niedermann.nextcloud.deckCompanion app for Nextcloud Deck
First release: Jan 17, 2025
Nextcloud Dev com.nextcloud.android.betaSynchronization client
First release: Jul 31, 2026
Nextcloud Notes it.niedermann.owncloud.notesView and edit notes on Nextcloud
First release: Sep 25, 2025
Nextcloud Passwords com.hegocre.nextcloudpasswordsSecure app for viewing passwords for the Nextcloud Passwords app
First release: Apr 27, 2025
Nextcloud Photo Widget io.github.an_dr_eas_k.ncphotowidgetHome screen widget showing random photos from your Nextcloud
First release: Oct 12, 2026
- Nextcloud Services com.polar.nextcloudservices
First release: Jun 15, 2024
Nextcloud Tables it.niedermann.nextcloud.tablesCompanion app for Nextcloud Tables
First release: Jun 19, 2025
NextDNS Manager com.doubleangels.nextdnsmanagementNextDNS Manager: Android app for easy NextDNS configuration management.
First release: Sep 18, 2025
- NextGIS Mobile com.nextgis.mobile
First release: Dec 28, 2016
Next Player dev.anilbeesetti.nextplayerFirst release: Sep 16, 2025
- NextPush org.unifiedpush.distributor.nextpush
First release: Feb 11, 2026
NextTraceroute com.surfaceocean.nexttracerouteFirst release: Jan 23, 2026
Nexus Command Center com.limecore.nexusOne Life Score for finance, fitness, study, work and habits
First release: Aug 4, 2026
NFC Alarm Clock com.nfcalarmclockCustomizable and feature-rich alarm clock app.
First release: Nov 22, 2025
- NFC Archiver com.nfcarchiver.nfc_archiver
First release: Jul 31, 2026
NFCGate de.tu_darmstadt.seemoo.nfcgateFirst release: Jun 14, 2025
- NFCMessageBoard com.briankhuu.nfcmessageboard
First release: Feb 16, 2025
- NFC Quick Settings au.id.colby.nfcquicksettings
First release: Sep 26, 2025
NFC Radio com.trapplab.nfc_radioSimple NFC audio player to start playback with NFC tags
First release: Feb 8, 2026
NFSee im.nfc.nfseeFirst release: Oct 8, 2026
NFSee (Debug) im.nfc.nfsee.debugRead Transit/Bank/ID cards/NFC tags on Android phones
First release: Jan 16, 2025
NGA客户端开源版 gov.anzong.androidngaFirst release: Sep 22, 2025
- Nian com.wordgame.nian
First release: Aug 10, 2026
- Nias for AnySoftKeyboard com.anysoftkeyboard.languagepack.nias
First release: Jul 31, 2026
Nibras Reader 3 khuta.org.nibras3.mobileFirst release: May 1, 2023
- NiDeau com.gitlab.schaerphix_tool_nideau.nideau
First release: Mar 9, 2024
Nightbell me.river.nightbellUptime monitoring that runs on your phone. No server, no account.
First release: Aug 13, 2026
- Night Clock com.firebirdberlin.nightdream.noGms
First release: Sep 18, 2026
Night Drop app.nightdropAnonymous, end-to-end encrypted 1:1 chat over Tor
First release: Aug 16, 2026
Nighthawk com.nighthawkapps.wallet.androidDarkFi testnet wallet — UnifOMR, Tor, DarkIRC (ngrok LWD)
First release: Dec 4, 2024
- Nightly me.knighthat.kreate.nightly
First release: Dec 10, 2025
- Night Screen com.skyd.nightscreen
First release: Jul 2, 2023
Nihonoari com.LAPARCELA.nihonoariA little and minimalist Japanese Kana training
First release: May 21, 2024
Ning de.csicar.ningFirst release: Oct 8, 2026
- Nitterify org.nuclearfog.nitterify
First release: Nov 22, 2025
Nitterium com.kaleedtc.nitteriumFirst release: Oct 23, 2026
Nix com.termux.nixFirst release: Jun 19, 2025
- NLWeer foss.cnugteren.nlweer
First release: Mar 26, 2025
- Nmail org.nostrmail.app
Take back your inbox. Private, decentralized mail that you truly own.
First release: Sep 14, 2026
- Nocean app.auriel.nocean
First release: Sep 22, 2026
- nocodb com.enm10k.nocodb
First release: Apr 24, 2024
- NodeLook ir.ammari.nodelook
First release: Aug 3, 2026
NÖ Finderlein at.finderlein.noeA companion app for the Lower-Austrian NÖ-Card
First release: Jun 10, 2023
- Noice com.github.ashutoshgngwr.noice
First release: Jun 2, 2024
- Noir Gym com.noirgym.app
First release: Aug 4, 2026
- NoiseCapture org.noise_planet.noisecapture
First release: Jul 8, 2025
Noise Timer com.chmouel.noisetimerCalming white, pink, and brown noise with a sleep timer
First release: Oct 26, 2026
NoMoreBackground com.adilhanney.no_more_backgroundFirst release: Jul 28, 2026
Nonius dev.kaleve.noniusTen measuring instruments. No ads, no trackers, no network.
First release: Sep 15, 2026
Nonogram com.sidhant.nonogramA free, open-source picture logic puzzle game with no ads or tracking
First release: Aug 1, 2026
NoNonsense Notes com.nononsenseapps.notepadA simple notepad and to-do app with an excellent navigation
First release: Aug 17, 2025
Nontrinsic xyz.linerly.nontrinsicWhere nonsense lives on.
First release: Jul 31, 2026
Noor Connect com.noorconnect.appPremium privacy-first Islamic companion: Quran, Qibla, Adhan, & Habit tracking.
First release: Aug 16, 2026
Nooto com.nooto.appCross-platform, privacy-focused notes with end-to-end encryption
First release: Oct 14, 2026
Nope Remote com.monuk7735.nope.remoteUniversal IR & Android TV remote control with custom remotes, buttons & macros.
First release: Jan 10, 2026
Noppa Dice Roller com.sanrou.noppadicerollerFirst release: Jul 31, 2026
Nora jp.nonbili.noraFirst release: Sep 12, 2025
Nori jp.nonbili.noriSave and find links with rich previews, lists, tags, and notes.
First release: Aug 16, 2026
- Norwegian for AnySoftKeyboard com.anysoftkeyboard.languagepack.norwegian
First release: Jul 31, 2026
- NoStorageRestrict com.github.dan.NoStorageRestrict
First release: Feb 12, 2024
nostrcal com.nostrcal.appFirst release: Oct 8, 2026
nostrmusic com.nostrmusic.appFirst release: Oct 8, 2026
Nostros com.nostrosFirst release: Mar 12, 2024
- Notally com.omgodse.notally
First release: Feb 25, 2025
NotallyX com.philkes.notallyxA simple and minimalistic open source notes app
First release: Jan 30, 2026
Not App Git gift.dhamma.noapp.gitFirst release: Oct 13, 2026
Note Calendar com.sztorm.notecalendarFirst release: Jul 28, 2025
- Note Companion com.limo.notecompanion
First release: Mar 4, 2024
Noted com.app.notedA simple and minimalist tracker app for all your entertainment.
First release: Sep 18, 2025
Notely Voice com.module.notelycompose.androidA Notes and AI Voice Transcription app
First release: Sep 24, 2025
Notepad com.farmerbb.notepadFirst release: Sep 22, 2024
- Note Pad com.xmission.trevin.android.notes
First release: Mar 27, 2025
notes dev.rova.notesFirst release: Feb 3, 2026
- Notes com.vayunmathur.notes
First release: Oct 8, 2026
Notes jl.musicalnotesFirst release: Sep 25, 2025
- Notes org.billthefarmer.notes
First release: Jun 9, 2023
Notes org.fossify.notesTo do list widget with a notebook organizer, checklist, simple shopping list
First release: Sep 1, 2025
- Notes org.secuso.privacyfriendlynotes
First release: Nov 5, 2025
Noteshop de.lxtools.noteshopFirst release: Oct 8, 2026
- NotesMaster com.pranshulgg.notesmaster
First release: Jun 17, 2025
Notesnook com.streetwriters.notesnookA fully open source & end-to-end encrypted note taking app
First release: Sep 19, 2025
NoteSR app.notesrFirst release: Oct 7, 2026
Notes Tech com.filestech.notes_techEncrypted Markdown notes, 100% local. No Internet permission.
First release: Sep 15, 2026
- No Thanks for Android eu.veldsoft.no.thanks
First release: Jan 22, 2024
- Notie com.cworld.notie
First release: Jul 30, 2026
- Notification Dictionary com.xtreak.notificationdictionary
First release: Feb 8, 2025
- NotificationLog de.jl.notificationlog
First release: Aug 1, 2025
- Notifications for FB org.surrel.facebooknotifications
First release: Jul 31, 2026
Notifications Recovery com.alftendev.notlistenerFirst release: Feb 3, 2026
Notification Vault com.zygisk_enc.notivaultFirst release: Jul 27, 2026
NotiFilter co.adityarajput.notifilterSilence annoying notifications
First release: Feb 9, 2026
- Noty com.noty.app
Pin your notes to notifications — always visible, never forgotten.
First release: Aug 5, 2026
- Nounours and friends ca.rmen.nounours
First release: Jul 31, 2026
- Nouto org.kaorun.nouto
First release: Aug 17, 2026
NOVA io.github.nofuturekid.novaOpen-source client for Unraid® NAS servers
First release: Oct 12, 2026
NovaDial com.novadial.phoneUnlock a secure, open-source calling experience with NovaDialer
First release: Aug 2, 2026
Nova Video Player org.courville.novaFirst release: Sep 14, 2025
- NovelDokusha my.noveldokusha
First release: Aug 6, 2024
Nov Open Reader net.cacheux.nvp.appSimple application to read content of Novopen insulin pens using NFC
First release: Dec 17, 2025
NoWakeLock com.js.nowakelockControl wakelocks, alarms & services
First release: Jul 26, 2025
- NowiChat com.nowichat
First release: Jun 3, 2025
- NowiPass com.nowipass
First release: Mar 24, 2025
NowiVault com.nothingsecureFirst release: Sep 20, 2025
Nozzle com.dluvian.nozzleFirst release: Feb 28, 2024
- NPatch top.nkbe.npatch
First release: Aug 14, 2026
NPSReact com.github.NPSReactFirst release: Apr 22, 2025
- NS-USBloader com.blogspot.developersu.ns_usbloader
First release: Sep 8, 2026
ntodotxt de.tnmgl.ntodotxtFirst release: Jan 5, 2026
Nullgram top.qwq2333.nullgramFirst release: Jul 6, 2025
- Numerus xyz.numerus
First release: Jul 31, 2026
Numio com.rr.numioA clean, open-source calculator with live results and unit conversion
First release: Oct 9, 2026
- Nunti com.nunti
First release: Jan 27, 2026
NutriXious org.ledjlale.NutrixiousFirst release: Aug 3, 2024
nutstash app.nutstash.walletFirst release: May 17, 2024
NWS Weather Alerts Widget net.justdave.nwsweatheralertswidgetFirst release: Dec 23, 2025
- NXT Remote Control org.jfedor.nxtremotecontrol
First release: May 28, 2025
- Nyan com.powerje.nyan
First release: Jul 31, 2026
NymVPN net.nymtech.nymvpnPrivate, secure Swiss dVPN. WireGuard, mixnet, decentralized proxy, no email.
First release: Sep 11, 2025
N-Zik-Foss com.nevar.nzik.fossMultilingual YT Music client
First release: Aug 10, 2026
NZ Tides com.palliser.nztidesFirst release: Aug 17, 2025
Oblique Strategies garden.lina.oblique_strategiesFirst release: Feb 19, 2024
- Oblivion net.oblivion.wipe
First release: Feb 3, 2026
Oblivion org.bepass.oblivionFirst release: Feb 20, 2025
- Obsidian md.obsidian
First release: Aug 26, 2025
- ObsidianTodoWidget de.yukigasai.obsidiantodowidget
First release: Oct 23, 2023
Obtainium dev.imranr.obtainiumFirst release: Sep 21, 2025
- Obtainium dev.imranr.obtainium.fdroid
Get Android app updates directly from the source
First release: Sep 21, 2025
ObtainX dev.bikram.obtainxFirst release: Aug 3, 2026
- Occtax fr.geonature.occtax2
First release: Jan 7, 2026
- OceanNex com.swatian.oceannex.free
First release: Jul 31, 2026
- Ocelot org.shirakumo.ocelot
First release: Jul 31, 2026
OCR io.github.subhamtyagi.ocrFirst release: Mar 8, 2025
- OCR io.github.subhamtyagi.ocr.core
First release: Aug 3, 2026
OC Remote dev.minios.ocremoteFirst release: Mar 13, 2026
- OCR (Ml Kit) org.totschnig.ocr.mlkit
First release: Mar 14, 2025
OCR (Tesseract) org.totschnig.ocr.tesseractFirst release: Oct 8, 2026
- OCS-NG Agent org.ocs.android.agent
First release: May 20, 2020
- OCS-NG Agent org.ocsinventoryng.android.agent
First release: Jul 31, 2026
Octi eu.darken.octiKeep an eye on your other Android devices: battery, WiFi, clipboard and more
First release: Feb 10, 2026
Octo dev.bg.octoAn unofficial FLOSS Octopus Energy agile tariff monitor
First release: Sep 12, 2025
Octo8 com.powerdino.splatoon3_companionAn app for checking current Splatoon 3 map schedules
First release: Aug 12, 2026
OctoDroid com.gh4aFirst release: May 30, 2025
OctoLab com.secninjaz.octolabUnofficial GitLab client for gitlab.com and self-hosted instances
First release: Oct 1, 2026
- OctoPrint For Android com.octo4a
First release: Jul 14, 2024
- OctoTC sadLogic.OctoTouchController
First release: Jul 31, 2026
- OctoTC sadLogic.OctoTouchController.foss
First release: May 12, 2025
- Odin threads.server
First release: Aug 27, 2025
- OdinTools de.langerhans.odintools
First release: May 25, 2024
Odysee com.odysee.flossExplore a whole universe of videos on Odysee from regular people just like you!
First release: Aug 10, 2026
- Odyssey org.gateshipone.odyssey
First release: May 20, 2025
Offenbach App de.ergosign.offenbach.fossFirst release: Oct 8, 2026
Off Grid AI ai.offgridmobileFirst release: Jul 15, 2026
- Öffi de.schildbach.oeffi
First release: Feb 11, 2026
Office com.vayunmathur.officeViewer/editor supporting ODF and Microsoft files, with E2EE collaboration
First release: Oct 12, 2026
- Office Break de.mysportsmate.officebreak
First release: Jul 31, 2026
Öffi Sounds de.oeffisounds.appPodcast app with ARD Sounds, BBC Sounds & public radio integration
First release: Aug 19, 2026
Offline Currency Converter com.offlinecurrencyconverter.appOffline currency converter with exchange rates, charts, and widget
First release: Aug 19, 2026
Offline Voice Input dev.notune.transcribeFirst release: Jul 19, 2026
- Offline Web Search io.github.rumcajs.offlinewebsearch
Search curated websites, blogs, and RSS feeds completely offline and privately.
First release: Jul 30, 2026
- OGN AR Viewer me.testcase.ognarviewer
First release: Jul 13, 2025
- OG Network Tools xyz.pisoj.og.nettools
First release: Feb 18, 2024
- OgreSampleBrowser org.ogre.browser
First release: Oct 9, 2024
Oinkoin Pro com.github.emavgl.piggybankproFirst release: Sep 19, 2025
- oj_helper com.example.oj_helper
First release: Jul 31, 2026
- oj_helper com.example.tmp
First release: Nov 19, 2025
- Ojo it.danieleverducci.ojo
First release: Apr 22, 2024
Oksigenia SOS com.oksigenia.oksigenia_sosSmart safety and distress alerts with fall and inactivity detection.
First release: Feb 7, 2026
- Olauncher app.olauncher
First release: Mar 6, 2025
- Old North Arabian for ASK com.anysoftkeyboard.languagepack.oldnortharabian
First release: Jul 31, 2026
Ollama com.freakurl.apps.ollamaChat with an Ollama server
First release: Sep 14, 2024
Olvid io.olvid.messenger.nogooglePrivate messaging for everyone
First release: Oct 8, 2026
- OmegaPlayer com.arslandaim.omegaplayer
First release: Aug 15, 2026
OMGSoundboard audio.omgsoundboardOMGSoundboard is a full soundboard app that will make your day a little brighter
First release: Sep 4, 2025
- OMN-Go net.basov.omngo
First release: Aug 2, 2026
- OMN-Go net.basov.omngo.fdroid
First release: Jul 31, 2026
- Omni uk.akane.omni
First release: Aug 6, 2025
OmniBeat omnibeat.appInternet radio player built to support all modern online stations.
First release: Sep 23, 2026
- ONB Staging com.zariep.opennavbar.debug
First release: Jan 29, 2026
- OneKeePass com.onekeepassmobile
First release: Dec 5, 2025
One Player com.googol.android.apps.oneplayerFirst release: Jul 29, 2026
OnePlus ARB Checker com.bartixxx.oneplusarbcheckerCheck Anti-Rollback (ARB) index for OnePlus devices to ensure safe updates.
First release: Aug 6, 2026
OnePlus Flash Control com.bartixxx.opflashcontrolFirst release: Jan 11, 2026
OnePlus Laser Tool com.bartixxx.distancemeterProfessional laser rangefinder for OnePlus devices with Laser AF hardware.
First release: Feb 10, 2026
OneSpend com.dowardev.onespendExpense and budget tracker that works offline, with optional self-hosted sync
First release: Oct 12, 2026
- OneTwo com.nicue.onetwo
First release: Sep 14, 2026
OnionShare (beta) org.onionshare.android.fdroidSecurely and anonymously share files using the Tor network
First release: Dec 13, 2025
Onloc app.onloc.androidSelf-hosted real-time device tracker.
First release: Jan 19, 2026
OnStop2FinishAndRemoveTask io.github.takusan23.onstop2finishandremovetaskIf change other app, Auto close task in prev app. Required Shizuku APP.
First release: Sep 17, 2026
OnTime si.jakobkreft.ontimeFirst release: Jul 22, 2025
- ONVIF Camera uk.org.retallack.onvifcamera
First release: Jul 31, 2026
Onyx fr.onyx.lyon1Your new app to guide you around La Doua Campus
First release: Aug 31, 2025
- OONI Probe org.openobservatory.ooniprobe
First release: Feb 19, 2025
OPA de.noisruker.openPasskeyAuthFirst release: Aug 3, 2026
Open 100x com.example.zoomhundredFirst release: Oct 7, 2026
- open2share top.linesoft.open2share
First release: Apr 13, 2024
Open Alert Viewer studio.okcode.open_alert_viewerFetch and display server alerts
First release: Nov 1, 2025
- Open Android Backup Companion mrrfv.backup.companion
First release: Jan 24, 2026
OpenArcade off.kys.openarcadeFirst release: Oct 8, 2026
OpenAssistant com.vayunmathur.openassistantA simple, open-source local AI app
First release: Dec 7, 2025
- OpenAthena™ for Android com.openathena
First release: Aug 17, 2025
- OpenAvisio org.openavisio.app
First release: Jul 31, 2026
OpenBanners Overlay org.openbanners.overlayRoute map overlay and mission tracker for Ingress mission banners.
First release: Oct 17, 2026
OpenBible com.schwegelbin.openbibleFirst release: Sep 18, 2025
- OpenBike dev.cyberme0w.openbike
First release: Jan 23, 2024
- Open Biking io.open_biking
First release: May 10, 2024
OpenBl com.Ounzy.OpenBlFirst release: Oct 19, 2026
OpenBoard org.dslul.openboard.inputmethod.latinAn opensource keyboard that does not spy on you!
First release: Aug 5, 2022
- OpenBooksDownloader com.nima.openbooksdownloader
First release: May 5, 2025
- Open Camera net.sourceforge.opencamera
First release: Jan 15, 2026
- OpenCloud eu.opencloud.android
First release: Aug 13, 2026
- OpenCloud eu.opencloud.android.debug
First release: Jul 24, 2025
- OpenCloud QA eu.opencloud.android.qa.debug
First release: Feb 19, 2026
OpenComicVine org.proninyaroslav.opencomicvineComic Vine client, website on comics
First release: Nov 15, 2025
OpenConnect net.openconnect_vpn.androidFirst release: Mar 3, 2025
- OpenContacts opencontacts.open.com.opencontacts
First release: Feb 10, 2026
openCook com.food.opencookRecipe manager to scan cookbook photos, plan your week and share the list
First release: Aug 9, 2026
- OpenDefault io.github.rickymohk.opendefault
First release: Apr 2, 2024
OpenDocument Reader at.tomtasche.readerDocument reader & file editor for Libreoffice & OpenOffice | ODF: ODT, ODS +more
First release: Oct 14, 2026
OpenDocument Reader at.tomtasche.reader.fossFirst release: Aug 10, 2026
- OpenDocument Reader at.tomtasche.reader.pro
First release: Jan 14, 2026
- OpenDrummer agrigolo.opendrummer
First release: Jan 19, 2026
- openDSP-4x4 net.opendsp.x4x4
First release: Jul 31, 2026
OpenDTU xyz.commanderred.opendtuappFirst release: Feb 12, 2026
- Open Ear com.openear.www
First release: Feb 7, 2025
Open Eats Journal com.drexeldevelopment.openeatsjournalOpen Eats Journal is a free nutrition, calories and weight tracking app
First release: Oct 15, 2026
OpenFoodFacts openfoodfacts.github.scrachx.openfoodFirst release: Oct 8, 2026
OpenFoodFacts org.openfoodfacts.scannerA more personal, helpful & knowledgeable Open Food Facts, private by default!
First release: May 15, 2025
- openHAB org.openhab.habdroid
First release: Feb 18, 2026
openHAB Beta org.openhab.habdroid.betaVendor and technology agnostic open source home automation
First release: Feb 3, 2026
OpenHIIT com.codepup.workout_timerOpenHIIT - Open Source Workout Interval Timer
First release: Feb 7, 2026
- Open Hitomi ai.agent1c.hitomi.open
First release: Jul 31, 2026
Opening Hours Manager de.mepi0011.openinghoursmanagerFirst release: Dec 23, 2025
- Open In WhatsApp io.github.subhamtyagi.openinwhatsapp
First release: Jul 23, 2024
OpenJot org.thegandabherunda.openjotA minimal UI, open-source journaling app built for distraction-free writing.
First release: Oct 8, 2026
- OpenKeychain org.sufficientlysecure.keychain
First release: Mar 5, 2024
OpenKuma app.openkumaRead-only viewer for your Uptime Kuma monitors. Private, no ads, no tracking.
First release: Aug 2, 2026
Openlib com.app.openlibdownload and read books from shadow library (Anna’s Archive)
First release: Mar 5, 2025
- Open Link With com.tasomaniac.openwith.floss
First release: Nov 27, 2020
- Open Link With: Redux com.samleatherdale.openwith.floss
First release: Jul 13, 2025
- OpenLynx page.codeberg.jumpingpants.opentransit
First release: Jul 9, 2024
Open Map org.osmdroidFirst release: Aug 26, 2024
- Open Markdown Notes (legacy mode) net.basov.omn.fdroid
First release: Aug 31, 2024
OpenMensa de.uni_potsdam.hpi.openmensaShow meal plans for more than 150 university canteens in Germany.
First release: Apr 9, 2025
OpenMoneyBox com.igisw.openmoneyboxBudget management application
First release: Jan 3, 2026
- OpenNavBar com.zariep.opennavbar
First release: Jan 29, 2026
- OPEN NGA dev.mlzzen.androidnga
Third-party client for bbs.nga.cn
First release: Jan 5, 2025
Open Notes com.opennotesA minimalist, secure, and fully offline notes app.
First release: Aug 17, 2025
OpenOdo ca.cyberengma.openodoPrivate offline vehicle logs, reminders, fuel and expense history
First release: Oct 2, 2026
OpenOrienteering Mapper org.openorienteering.mapperCreate maps for the orienteering sport
First release: Nov 14, 2025
- OpenPaperView net.phbwt.paperwork
First release: Jan 7, 2026
Open Patience io.github.d_rk.openpatienceFree, open-source Klondike & FreeCell solitaire — no ads, no tracking
First release: Sep 29, 2026
Open Photo Frame io.github.micw.openphotoframeTurn your old Android tablet into a beautiful digital photo frame.
First release: Jan 29, 2026
OpenPillReminder dev.mariinkys.OpenPillReminderOpen source lady pill (birth control) tracker
First release: Oct 10, 2026
OpenPlants com.domai_tb.openplantsOpen-source & privacy-friendly companion app for your plants
First release: Oct 9, 2026
- OpenPods com.dosse.airpods
First release: Oct 2, 2025
Openreads software.mdev.bookstrackerPrivate and open source books tracker, organizer and reading list.
First release: Sep 9, 2025
Open Recorder com.openrecorder.appFirst release: Sep 27, 2026
openScale com.health.openscaleWeight and body metrics tracker, with support for Bluetooth scales
First release: Jun 27, 2025
- openScale com.health.openscale.debug
First release: Jan 23, 2026
openScale sync com.health.openscale.syncSynchronize your openScale measurements with external services
First release: Aug 25, 2025
- openScale sync com.health.openscale.sync.debug
First release: Jan 5, 2026
OpenScan com.ethereal.openscanFirst release: Oct 17, 2026
OpenSCQ30 com.oppzippy.openscq30First release: Jan 23, 2026
- OpenSEPTAmap com.tre.openseptamap
First release: Aug 10, 2025
Openshelf org.ftena.openshelfFree, open-source personal library manager and book tracker.
First release: Jul 29, 2026
- Open SSTP Client kittoku.osc
First release: Aug 21, 2025
- Open Stable Diffusion com.openstablediffusion
First release: Apr 12, 2024
OpenStop de.tu_chemnitz.etit.sse.openstopThe app for collecting barrier data in local public transport.
First release: Dec 16, 2025
OpenStore dev.mi6e4ka.openstoreLibre client for popular russian app store
First release: Nov 11, 2025
- OpenStreetMap wiki app com.tre.openstreetmapwiki
First release: Jun 22, 2025
Open Sudoku org.moire.opensudokuOpen Sudoku is an Open Source Sudoku game.
First release: Aug 19, 2025
- OpenSyncedLists eu.schmidt.systems.opensyncedlists
First release: Jul 1, 2025
- OpenTapasReader com.github.trilinder.tapasclient
First release: Jan 26, 2024
- Open TeleScope VR io.github.digvijaylp.OpenTeleScopeVR
First release: Sep 15, 2026
- OpenToday com.fazziclay.opentoday
First release: Nov 5, 2023
- OpenTodoList net.rpdev.opentodolist
First release: Jan 11, 2025
OpenTopoMap org.nitri.opentopoFirst release: Jan 3, 2026
- OpenTracks de.dennisguse.opentracks
First release: Jul 31, 2026
- OpenTracks de.dennisguse.opentracks.playstore
First release: Aug 24, 2025
OpenTTD org.openttd.sdlFirst release: Apr 11, 2023
- OpenTune com.Arturo254.opentune
First release: Feb 3, 2026
OpenUSOS com.open_usosAn open source unofficial USOS app, for students in Poland
First release: Oct 3, 2024
Open Video Editor io.github.devhyper.openvideoeditorFirst release: Sep 2, 2024
OpenVine ch.betzengineering.openvineRecord and stitch 6-second video clips. Offline and private.
First release: Oct 7, 2026
OpenVitals tech.mmarca.openvitalsPrivate Health Connect dashboard. No account, no cloud, no ads.
First release: Jul 31, 2026
- OpenVitals Debug tech.mmarca.openvitals.debug
First release: Aug 4, 2026
- OpenVK uk.openvk.android.legacy
First release: Dec 9, 2023
OpenVPN for Android de.blinkt.openvpnOpenVPN without root
First release: Jan 30, 2026
OpenWOL com.juliencardoux.openwolOpenWOL is a simple, private and efficient Wake-on-LAN app for Android.
First release: Oct 8, 2026
- openWorkout com.health.openworkout
First release: Aug 24, 2025
- OpenWrt Manager com.hg.openwrtmanager
First release: Jun 4, 2025
openZinkBooth com.photo.openzinkboothFirst release: Oct 8, 2026
Operator com.byarchitect.operatorList and kill processes that consume a lot of resources
First release: Nov 30, 2025
- OPN2 MIDI Player ru.wohlsoft.opnmidiplayer
First release: Sep 21, 2025
OPNsense Manager com.dt.opnsense_managerManage OPNsense firewall: monitor, configure rules, view logs & services
First release: Sep 8, 2026
- Opus 1 Music Player de.kromke.andreas.opus1musicplayer
First release: Sep 3, 2025
- Ordunte eus.ordunte.app
First release: Aug 23, 2026
Organic Maps app.organicmapsFirst release: Oct 8, 2026
- Organic Maps app.organicmaps.web
First release: Sep 15, 2025
- orgnote org.note.app
First release: May 6, 2025
Orgro com.madlonkay.orgroLive your life in Org Mode? Take it with you on your Android device.
First release: Feb 7, 2026
Orgzly Revived com.orgzlyrevivedFirst release: Aug 11, 2025
Oriens lab.rreedd.oriensFirst release: Jul 8, 2025
- Orientation Lock com.tuyafeng.orientationlock
First release: May 27, 2024
- oRing - Reminder com.lubenard.oring_reminder
First release: Jan 14, 2023
Orion Master com.tallydigital.oomdroidNative 1oom port of Master of Orion (1993). Requires your own LBX files
First release: Sep 14, 2026
Orion Viewer universe.constellation.orion.viewerFirst release: May 14, 2025
- Oscilloscope org.billthefarmer.scope
First release: Aug 2, 2026
Oshi Uploader org.codeberg.quecomet.oshian Android app that can upload to any Oshi instance
First release: Apr 3, 2025
- osm2gmaps net.retiolus.osm2gmaps
Convert coordinates and map links between formats, services and apps
First release: Nov 21, 2025
OsmAnd~ net.osmand.plusGlobal Mobile Map Viewing & Navigation for Offline and Online OSM Maps
First release: Mar 16, 2026
- OsmBugs org.gittner.osmbugs
First release: Nov 19, 2024
- OSM Dashboard de.storchp.opentracks.osmplugin
First release: Feb 2, 2026
OSM Dashboard (Offline) de.storchp.opentracks.osmplugin.offlineFirst release: Jul 26, 2025
- OSMfocus Reborn net.pfiers.osmfocus
First release: Aug 3, 2024
- Osm Go! fr.dogeo.osmgo
First release: Jul 5, 2024
- osmin io.github.janbar.osmin
First release: Sep 27, 2025
Osmosis dev.konraditurbe.osmosisCopy photos and videos off DJI Osmo cameras over Bluetooth and Wi-Fi
First release: Oct 22, 2026
- OSMTracker for Android™ net.osmtracker
First release: Sep 12, 2025
Osram remote org.talkingpanda.osram_remoteAn app to turn your phone into a remote for lights
First release: Feb 19, 2024
OSRS Wiki com.omiyawaki.osrswikiUnofficial Old School RuneScape wiki reader with offline save and map
First release: Oct 15, 2026
OSS Card Wallet com.akylas.cardwalletFirst release: Sep 26, 2025
- OSS Dict com.akylas.aard2
First release: Jun 17, 2025
- OSS Document Scanner com.akylas.documentscanner
First release: Feb 17, 2025
OSS Weather com.akylas.weatherFirst release: Jan 19, 2026
OTG Master app.fayaz.otgmasterMount VeraCrypt and LUKS encrypted USB drives on non-rooted Android
First release: Sep 20, 2026
Otic com.sakethh.oticMinimal Android app to stream microphone input to the local network.
First release: Dec 18, 2025
Otoscope dev.rubec.otoscopeAd-free viewer for WiFi otoscope cameras.
First release: Jul 31, 2026
- Otraku com.otraku.app
First release: Dec 26, 2025
Oubliettes io.github.all3f0r1.oubliettesDungeon logic puzzle: find the walls from the row and column counts
First release: Oct 10, 2026
Oui Lookup org.alberto97.ouilookupFind a device's manufacturer by its MAC address and browse OUIs assignments
First release: Jul 24, 2025
Ouisync org.equalitie.ouisyncFirst release: Sep 1, 2025
- OuterTune com.dd3boh.outertune
First release: Sep 25, 2025
- Outfield com.matt.outfield
First release: Feb 6, 2025
Outline org.outline.android.clientFirst release: Mar 3, 2023
- Outline Keeper org.sirekanyan.outline
First release: Feb 11, 2024
Outspoke dev.brgr.outspokeFirst release: Aug 24, 2026
Overload cloud.pablos.overloadFirst release: Oct 14, 2026
Overmorrow com.marotidev.Overmorrowmodern material design weather app
First release: Jan 17, 2026
- OW Camera 2 for Pebble com.github.jamsinclair.owcamera2
First release: Jul 31, 2026
- ownCloud com.owncloud.android
First release: Dec 9, 2025
OwnDroid com.bintianqi.owndroidFirst release: Feb 4, 2026
OwnTracks org.owntracks.androidYour location companion
First release: Dec 28, 2025
oxproxion io.github.stardomains3.oxproxionChat with OpenRouter, Ollama, LM Studio and llama.cpp AI models
First release: Sep 23, 2025
Oyatsu lab.rreedd.oyatsuFirst release: Jul 7, 2025
P2Play org.libre.agosto.p2playFirst release: Dec 31, 2025
Pachli app.pachliFirst release: Sep 14, 2025
- Package Manager com.smartpack.packagemanager
First release: Nov 1, 2025
PadConnect io.github.padconnectTurn your phone into a PC game controller
First release: Aug 23, 2026
- Padland com.mikifus.padland
Padland is a tool to manage, share, remember and read collaborative documents ba
First release: Dec 20, 2025
- pagan com.qfs.pagandev
First release: Jul 10, 2026
Pagan com.qfs.paganA Mobile Music Sequencer
First release: Feb 7, 2026
- Page com.page.bizzle
First release: Nov 2, 2024
Pageless live.pageless.mobileOffline-first audiobook player for your self-hosted Pageless server.
First release: Aug 10, 2026
PAIesque org.ojrandom.paiesquePrivacy-first fitness tracker with end-to-end encrypted group sharing
First release: Dec 23, 2025
- Pain Diary org.secuso.privacyfriendlypaindiary
First release: Jul 29, 2025
Paint org.fossify.paintQuick, easy and open source drawing app
First release: Jul 22, 2025
- Paintball Notificator com.chaser.paintballnotificator
First release: Apr 29, 2024
- PairDrop com.fmsys.snapdrop
First release: Feb 13, 2025
PairFree io.github.omegadestroyer.pairfreeOne light app for earbuds of many brands. No account, no internet, no tracking
First release: Oct 18, 2026
Palčka si.palcka.tarokFirst release: Feb 1, 2025
Palimpsest app.palimpsestEncrypted notes, diary and to-dos with hidden vaults behind one password
First release: Oct 15, 2026
Pangolin net.pangolin.PangolinFirst release: Feb 20, 2026
- Pani info.ilyac.pani
First release: Apr 2, 2025
Panoramax app.panoramaxFirst release: Jun 2, 2025
Panoramicon eu.domob.panoramiconFirst release: Feb 6, 2026
Pano Scrobbler com.arn.scrobbleFeature packed cross-platform music tracker
First release: Feb 4, 2026
PanOSP fr.gibinot.panospLightweight, configurable AOSP-style quick settings panel for Android.
First release: Sep 14, 2026
Pantry dev.casraf.pantryShared household lists, photos & notes on your own server — and on your watch.
First release: Aug 9, 2026
PaperCript com.javimetallab.papercriptEncrypted passwords on printable QR cards. No network, stores nothing.
First release: Oct 31, 2026
Paperize com.anthonyla.paperizePaperize is an efficient wallpaper changer application with a clean design
First release: Sep 15, 2025
- PaperKnife com.paperknife.app
First release: Feb 14, 2026
PaperKnife+ com.paperknifeplus.appPrivacy-first PDF utility: merge, split, rotate, and protect
First release: Oct 22, 2026
- PaperLaunch de.devmil.paperlaunch
First release: Dec 31, 2025
Paperless Go com.ventouxlabs.paperlessgo.nogoogleA modern mobile client for your Paperless-ngx document management server.
First release: Oct 8, 2026
Paperless Mobile de.astubenbord.paperless_mobileFirst release: Jan 18, 2024
Paperless NGX Uploader net.gmartin.paperlessngx_uploaderUpload documents to a Paperless-NGX server using the native share intent
First release: Sep 1, 2025
Paper Loop paper.loopFirst release: Oct 8, 2026
Paper Loop 2 paper.loop2First release: Oct 8, 2026
- PaperTerm io.paperterm.app
First release: Aug 5, 2026
PaperWise org.paperwise.appFirst release: Jul 29, 2025
Pappus dev.calyptra.pappusFrom the plan to the settle-up — everything your trips involve
First release: Oct 23, 2026
Parakeetype org.schabi.parakeetypeFast on-device speech-to-text keyboard and voice input - no cloud, no tracking.
First release: Oct 9, 2026
- Paranoid's Pal - Privacy Lock com.paranoid.privacylock
First release: Jul 31, 2025
Parcel 取件码 com.xxxx.parcelExtract the address and pickup code from SMS automatically
First release: Jan 27, 2026
PariDroid fr.ubordeaux.math.paridroidFirst release: Oct 8, 2026
Paris transport traffic fr.corenting.traficparisTraffic information for subway/tramway... (Paris and suburbs)
First release: Dec 10, 2025
Parti io.gitlab.carsten_scholtes.partiHelp with partitioning into fractional parts (compute lcm).
First release: Mar 27, 2024
- ParticleSim com.tss.android
First release: Apr 21, 2020
- Party UP! me.ocv.partyup
First release: Jul 31, 2026
- Party UP! dbg me.ocv.partyup_dbg
First release: Jan 8, 2026
- Paseo ca.chancehorizon.paseo
First release: Jan 3, 2026
Paseo sh.paseoFirst release: Aug 31, 2026
Passchain s1m.hwfido2providerUse security key with Bluetooth, NFC, USB or your phone secure element
First release: May 7, 2025
- PAssist com.github.frimtec.android.pikettassist
First release: Sep 17, 2025
Passman es.wolfi.app.passmanAllow you to manage the credentials stored in your Nextcloud Passman app.
First release: Jun 15, 2025
PassPony com.passpony.androidPassword manager for pass and passage stores, synced with git
First release: Oct 4, 2026
- Passtable com.ladsers.passtable.android
First release: Feb 6, 2025
PasswdSafe com.jefftharris.passwdsafeFirst release: Sep 14, 2025
- PasswdSafe Sync com.jefftharris.passwdsafe.sync
First release: Nov 11, 2025
- PasswordGenerator org.wbftw.weil.passwordgenerator
First release: Jan 22, 2025
Password Generator com.vecturagames.android.app.passwordgeneratorPassword Generator is an app for generating secure passwords
First release: Jun 1, 2025
- Password Generator org.secuso.privacyfriendlypasswordgenerator
First release: Jul 20, 2025
- Password Master com.vecturagames.android.app.passwordmaster
First release: Jun 1, 2025
Password Monitor com.password.monitorEnsure your password safety by scanning for potential breaches.
First release: Dec 24, 2024
- Passwords com.vayunmathur.passwords
First release: Oct 8, 2026
- Passwords org.css_apps_m3.password_manager
First release: Feb 5, 2026
Password Store app.passwordstore.agrahnManage your passwords & passkeys
First release: Sep 5, 2025
Password Store app.passwordstore.pando85Manage your passwords
First release: Jul 28, 2026
Passy com.glitterware.passyOffline password manager with cross-platform synchronization
First release: May 29, 2025
Patch Pilot de.thewolfwalkexperience.software.patchpilotManage presets on your hardware synth over USB, straight from your phone
First release: Oct 14, 2026
Path com.sidhant.pathLightweight, privacy-first step tracker. No tracking, no ads, 100% open source.
First release: Sep 26, 2026
- Pause com.dtsykunov.pause
First release: Aug 16, 2026
- Pausing Healthily org.secuso.privacyfriendlypausinghealthily
First release: Dec 19, 2025
- Payload Dumper com.rajmani7584.payloaddumper
First release: Feb 26, 2025
- Payload Dumper com.rhythmcache.payloaddumper
First release: Dec 31, 2025
- Pazzword com.cyb3rko.pazzword
First release: Oct 18, 2024
PB Schedule Viewer com.metalshard.hyperionFirst release: Oct 8, 2026
- PCAPdroid com.emanuelef.remote_capture
First release: Sep 3, 2025
PCAPdroid mitm com.pcapdroid.mitmFirst release: Oct 27, 2024
P.CASH cash.p.terminalFirst release: Sep 19, 2025
- PC Numpad for AnySoftKeyboard com.anysoftkeyboard.languagepack.numpad
First release: Jul 31, 2026
pcontacts io.pcontacts.appSync Proton Mail contacts into the Android system address book.
First release: Aug 10, 2026
PdDroid Party cx.mccormick.pddroidpartyFirst release: Oct 8, 2026
PDF com.vayunmathur.pdfA simple, open-source PDF viewing app
First release: Dec 26, 2025
PDF Doc Scan com.littletrickster.scannerFirst release: May 25, 2023
- PDF Inspector SVS.pdfinspector
First release: Jul 31, 2026
- PDF to Images uk.me.paraskos.pdfrenderer
First release: Feb 26, 2024
- PDF Toolkit com.yourname.pdftoolkit
First release: Aug 10, 2026
PDFUnlocker io.openappex.pdfunlockerUnlock password-protected PDF files locally on Android.
First release: Oct 8, 2026
PDF Viewer app.grapheneos.pdfviewerFirst release: Jan 19, 2026
PDF Wallet com.michaeltroger.gruenerpassSimple PDF Wallet for your most important PDFs
First release: Feb 8, 2026
- PeakOrama org.woheller69.PeakOrama
First release: Sep 5, 2025
Pearlnode com.pearlnodeFirst release: Oct 8, 2026
PearPass com.pears.passFirst release: Feb 27, 2026
PebbleNTN com.pebblentn.appTurn-by-turn directions from your phone's nav apps on your Pebble watch
First release: Sep 21, 2026
PebbleRecorder com.pebblerecorder.appTurn a Pebble watch button into a remote start/stop trigger for audio recording.
First release: Sep 29, 2026
- Pedometer org.secuso.privacyfriendlyactivitytracker
First release: Aug 2, 2025
Peercoin com.coinerella.peercoinYour mobile wallet for Peercoin and Peercoin testnet.
First release: Aug 17, 2025
- PeerPop ac.ella.peerpop
A service app providing PeerTube contents to Podcini.A
First release: Sep 18, 2026
PeerTube org.framasoft.peertubeFirst release: Sep 26, 2026
- PeerTube Live fr.mobdev.peertubelive
First release: May 28, 2024
- PeerTube Redirect dev.zwander.peertuberedirect
First release: Oct 8, 2026
Pengeek name.monwf.customiuizerFirst release: Sep 25, 2025
PennyWise AI - Expense Tracker com.pennywiseai.trackerFirst release: Sep 18, 2025
- Perceived Stress Scale biz.binarysolutions.stress
First release: Jul 17, 2025
Perfice io.perfice.appTrack anything, find the patterns that shape your life
First release: Oct 8, 2026
- Periodical de.arnowelzel.android.periodical
First release: Nov 15, 2025
Peristyle app.simple.periSimple wallpaper manager app with Auto Wallpaper and Multi Folder support.
First release: Sep 23, 2025
Permission Manager X com.mirfatif.permissionmanagerxFirst release: Oct 8, 2026
Permission Pilot eu.darken.mypermAndroid app permission overview
First release: Jul 2, 2025
Permissions Summary com.simpol.permissionssummaryFirst release: Aug 16, 2025
Persian Calendar com.byagowi.persiancalendarFirst release: Sep 15, 2025
- Persian for AnySoftKeyboard com.anysoftkeyboard.languagepack.persian
First release: Jul 31, 2026
personalDNSfilter dnsfilter.androidDNS request based Host Blocker over local VPN using a Blocklist
First release: Jan 23, 2026
- Personal Health Records com.taotao.healthtracker
First release: Aug 11, 2026
Personal Stuff m.co.rh.id.a_personal_stuffApp used to track, manage and remind you of your own stuff.
First release: Jan 12, 2026
Petals br.com.colman.petalsFirst release: Aug 16, 2025
PGPMailer com.pgpmailerFirst release: Oct 8, 2026
PGPony com.pgpony.androidEncrypt, decrypt and sign with OpenPGP. Post-quantum keys and security keys.
First release: Aug 1, 2026
Phantasialand Waiting Times com.quantum_prof.phantalandwaittimesLive wait times for Phantasialand rides
First release: Jul 6, 2025
- PhantomProcessesSavior com.yhc.phantom.processes.savior
First release: Dec 12, 2023
Phase 10 Counter com.tjEnterprises.phase10CounterFirst release: Feb 5, 2025
phiola com.github.stsaz.phiolaFast audio player, recorder, converter
First release: Sep 6, 2025
Phocid org.sunsetware.phocidFirst release: Sep 19, 2025
Phone org.fossify.phoneUnlock a secure, open-source calling experience with Fossify Phone
First release: Sep 17, 2025
- PhoneProfilesPlus sk.henrichg.phoneprofilesplus
First release: Sep 24, 2025
- PhoneProfilesPlusExtender sk.henrichg.phoneprofilesplusextender
First release: Jun 25, 2025
PhoneTrack com.gideontek.phonetrackLocation sharing over SMS — so simple. GPS phone tracking with permission.
First release: Oct 27, 2026
Phonograph Plus player.phonograph.plusA revived classic material designed local music player for Android
First release: Feb 5, 2026
- Phonograph Plus Preview player.phonograph.plus.preview
First release: Feb 14, 2026
- PhotoChiotteC la.daube.photochiotte.c
First release: Feb 1, 2026
- Photo Editor com.burhanrashid52.photoediting
First release: Mar 16, 2026
- Photo Editor com.burhanrashid52.photoeditor
First release: Jul 31, 2026
Photon dev.abhi.photoncross-platform file-sharing
First release: Jan 5, 2025
- PhotonCamera com.particlesdevs.photoncamera
First release: Nov 2, 2024
PhotoPrism Gallery ua.com.radiokot.photoprismFirst release: Aug 29, 2025
Photos com.kaii.photosA no non-sense, stylish, and performant gallery app
First release: Jan 5, 2026
- Photos com.vayunmathur.photos
A photos app with a full editor and on-device AI search
First release: Jul 29, 2026
- PhotoSphere Gallery org.eagsoftware.photospheregallery
First release: Sep 30, 2025
PhotoSwooper com.example.photoswooperA dating app for your photos & videos
First release: Nov 30, 2025
phylactere com.guillot.phylactereAdd speech bubbles to your photos
First release: Oct 8, 2026
- Phylax com.asksakis.freegate
First release: Aug 13, 2026
phyphox de.rwth_aachen.phyphoxProvádějte fyzikální experimenty s pomocí svého mobilního telefonu.
First release: Jul 6, 2025
PI dev.sanmer.piFirst release: Nov 22, 2025
- PianOli com.nicobrailo.pianoli
First release: Jan 31, 2024
PIA VPN com.privateinternetaccess.androidFast, secure and open source VPN client for Android.
First release: Aug 7, 2026
- Picard Barcode Scanner org.musicbrainz.picard.barcodescanner
First release: Nov 25, 2025
PicCollage com.tailgunnerx.piccollageHigh-performance photo collage studio with 26 dynamic gradients and pro layouts.
First release: Oct 8, 2026
PicGuard com.kjxbyz.picguardFirst release: Sep 20, 2025
- Picocrypt-NG io.github.picocrypt_ng.picocrypt_ng
First release: Jul 31, 2026
Pico Streaming App org.esiliati.repo.picostreaming.appFirst release: Oct 8, 2026
Pictionary Generator red.pictionary_generatorFirst release: Oct 8, 2026
- Piedmontese for AnySoftKeyboard com.anysoftkeyboard.languagepack.piedmontese
First release: Jul 31, 2026
- Pie Launcher de.markusfisch.android.pielauncher
First release: Jun 30, 2025
- Piggsy com.nvllz.piggsy
First release: Sep 22, 2025
PikaTorrent com.pikatorrent.PikaTorrentFirst release: Jul 30, 2025
- Pilagá for AnySoftKeyboard com.anysoftkeyboard.languagepack.pilaga
First release: Jul 31, 2026
PilcrowMD com.pilcrowmdRead & edit Markdown beautifully. No ads, no account, open source.
First release: Sep 3, 2026
Pile es.pileFirst release: Jul 31, 2026
PiliPala com.guozhigq.pilipalaA third-party Bilibili client developed in Flutter
First release: Apr 2, 2025
- PillDroid net.foucry.pilldroid
First release: Jul 31, 2026
Pill Time com.cliambrown.pilltimeKeep track of meds that can be taken as needed (not at a specific time)
First release: Nov 13, 2025
Pimi widget com.kolakek.pimiwidgetYour day, at a glance - with built-in weather app
First release: Nov 23, 2025
PINcredible de.cyb3rko.pincredibleFirst release: Apr 27, 2025
- Pineapple Lock Screen net.blumia.pineapple.lockscreen.oss
Help you turn your phone screen off (lock screen) without using power button.
First release: Feb 4, 2026
Pinepods com.gooseberrydevelopment.pinepodsFirst release: Nov 4, 2025
PingOff com.jarsilio.android.pingoffSilence your phone automatically when using selected apps.
First release: Apr 13, 2025
- Ping Utils com.github.axet.pingutils
First release: Dec 18, 2024
Pinkt com.fibelatti.pinboardFirst release: Jan 19, 2026
- PIN Mnemonic org.secuso.privacyfriendlypin
First release: Jul 4, 2025
- PinPoi io.github.fvasco.pinpoi
First release: Nov 7, 2024
- Pinpoint org.pinpoint
First release: Sep 22, 2026
Pinry dev.relony.pinryBrowse and pin to your self-hosted Pinry server
First release: Oct 15, 2026
Pinyin Web & EPUB and topolects org.ucam.ssb22.pinyinfdroidAdds Pinyin or Cantonese etc to websites and EPUBs
First release: Feb 26, 2026
Pioneer com.ki_bun.pioneerFirst release: Jul 29, 2026
- PipePanic org.olgsoft.apipepanic
First release: May 30, 2024
- PipePipe Beta project.pipepipe.app
First release: Dec 1, 2025
Pipes com.sidhant.pipesTap and rotate pipes to solve the water network. Relaxing offline logic puzzles!
First release: Oct 16, 2026
- Pipes com.vayunmathur.games.pipes
First release: Jul 29, 2026
PiPixiv com.mrl.pixivThird-party Pixiv Client
First release: May 17, 2025
- Pirate Solitaire io.itch.pirate_solitaire
First release: Apr 14, 2024
- Pirátská Nástěnka cz.pirati.nastenka.twa
First release: Apr 5, 2024
Pitak dev.khoj.pitaka.fdroidPrivacy-first offline library catalogue with an encrypted lending vault
First release: Aug 1, 2026
pitcher com.k1.pitcherChange the key of any song, keep the tempo. Tuner, loops, speed. Offline.
First release: Oct 13, 2026
PitchVis org.p1graph.pitchvisFirst release: Jul 31, 2026
Piwigo NG com.piwigo.piwigo_ngFirst release: Jan 2, 2026
Pixabay com.ahmadrezagh671.pixabayFirst release: Jun 24, 2025
Pixel 5G io.github.saeeddev94.pixelnrConfig pixel modem NR mode
First release: Aug 27, 2025
- PixelDroid org.pixeldroid.app
First release: Sep 25, 2025
Pixelix com.daniebeler.pfpixelixFirst release: Feb 10, 2026
- PixelPlayerOSS com.lostf1sh.pixelplayeross
First release: Jul 31, 2026
Pixel Tag Drawer com.iwadjp.pixeltagdrawerOrganize and launch Android apps with tags and usage-based sorting.
First release: Sep 25, 2026
Pixel Wheels com.agateau.tinywheels.androidAre your driving skills up to this challenge?
First release: Dec 20, 2025
PixEz com.perol.pixezFirst release: Jul 27, 2025
- Pix-EzViewer com.perol.asdpl.play.pixivez
First release: Jun 30, 2025
- Pix-EzViewer com.perol.asdpl.play.pixivez.libre
First release: Jul 31, 2026
- Pixiv for Muzei 3 com.antony.muzei.pixiv
First release: Nov 23, 2025
- Pixiv-MultiPlatform top.kagg886.pmf
First release: Aug 30, 2025
PlainApp com.ismartcoding.plainManage your phone on the web! Access files, photos, videos, music & more.
First release: Feb 11, 2026
- plainer sh.looker.plainer
First release: Aug 1, 2026
Planes com.planes.androidPlanes Android is a variant of the Battleships game for Android
First release: Aug 6, 2025
- PlaneSpotter org.woheller69.planespotter
First release: Dec 11, 2025
- Planetario com.jacquesb.planetario_a
First release: Jan 2, 2025
PlaneTxt fr.rvier.planetxtTodo, agenda, journal and notes in plain Markdown files
First release: Oct 11, 2026
- Planisphere org.tengel.planisphere
First release: Jul 11, 2025
Plant-it com.github.mdeluise.plantitFirst release: Jan 7, 2026
- Play Deals me.sujanpoudel.playdeals
First release: Jan 23, 2024
- PlayHex org.playhex.twa
First release: Dec 8, 2025
- Play Maker nodomain.playmaker
First release: Jul 31, 2026
- Play NotePad com.mshdabiola.playnotepad.foss
First release: Feb 1, 2025
PlayOnDlna io.github.scovillo.playondlnaFirst release: Sep 2, 2025
PlayTube com.arslandaim.playtubeFeature-rich YouTube client, simple fast and secure.
First release: Jul 31, 2026
- Plees Tracker hu.vmiklos.plees_tracker
Plees Tracker is a simple sleep tracker for your Android phone.
First release: Aug 4, 2025
Plexus tech.techlore.plexusCheck apps for compatibility with de-Googled device
First release: Aug 30, 2025
PlugBrain app.plugbrain.androidFirst release: Sep 6, 2025
Plunge Tracker io.github.jherforth.plungetrackerOffline cold plunge timer and log. No accounts, no network, no tracking.
First release: Oct 4, 2026
- Plus Plus Battery com.dijia1124.plusplusbattery
First release: Sep 13, 2025
- Plutonic com.game.plutonic
First release: Sep 19, 2026
- PMX Pro com.mirfatif.permissionmanagerx.pro
First release: Dec 2, 2025
- PObY-A ch.ictrust.pobya
First release: Feb 16, 2025
- Počasí v krajích cz.jirkovsky.lukas.chmupocasi
First release: Dec 4, 2020
Pocket2FA net.gmartin.pocket2faSecure 2FA code client of 2FAuth server that works offline
First release: Oct 25, 2026
- Pocket Broomball com.simondalvai.pocketbroomball
First release: Mar 26, 2025
Pocket Casts au.com.shiftyjelly.pocketcastsFirst release: Sep 15, 2025
PocketCheck org.gonbei774.pocketcheckA working memory app - "Anything to put in your pocket?"
First release: Feb 10, 2026
PocketDhamma com.s4nj1th.pocket_dhammaAn offline reader for the Dhammapada.
First release: Jun 11, 2025
- Pocket Mode com.artemchep.pocketmode
First release: Aug 3, 2026
- Pocket Paint org.catrobat.paintroid
First release: Jul 30, 2026
PocketPal com.pocketpalaiFirst release: Aug 20, 2025
- PocketPlan com.pocket_plan.j7_003
First release: Sep 21, 2025
Pocket Prose de.singular.writerA writing app for a folder of Markdown notes, filed by tag.
First release: Sep 17, 2026
- Pocket ReadLex uk.co.busydoingnothing.pocketrl
First release: Jan 20, 2025
Pocket Sense ace.software.pocketsensePrivate, offline money tracker in English and Arabic, in JOD and 27 currencies
First release: Oct 17, 2026
PocketTracker com.conanizer.pockettrackerTracker-style music maker for handhelds and phones — sampler, SF2, 8 tracks
First release: Aug 23, 2026
PocketTRacker org.sbv.pockettrackerReliably tracks and analyses the scores of your straight pool games
First release: Jan 3, 2026
- PodAura com.skyd.anivu
First release: Sep 11, 2025
- Podcini.A ac.mdiq.Podcini.A
Your premier podcast/media instrument, now extensible, capable of YouTubing
First release: Jul 31, 2026
- Podcini.X ac.mdiq.podcini.X
First release: Jan 19, 2026
podium app.podiumpodcasts.podiumFirst release: Sep 23, 2026
Poet Assistant ca.rmen.android.poetassistantDictionary and TTS tools for editing poems
First release: Jan 5, 2025
Point Forecast com.crome.forecastpointNWS point forecasts with maps, tides, and weather hazards
First release: Aug 26, 2026
Pokebase com.mouzinho.pokebaseBrowse Pokémon and TCG cards with search, filtering, and offline caching.
First release: Oct 8, 2026
Poker Payout com.huntercoles.pokerpayoutPoker timer and blind clock for Texas Hold'em home games: payouts, buy-ins, bank
First release: Dec 14, 2025
- PokerTracker com.github.saikcaskey.pokertracker
Personal poker tracking app
First release: Sep 25, 2025
Pokéverse com.aditya1875.pokeverseExplore, collect, and manage your Pokémon universe in one app!
First release: Jan 28, 2026
Polaris agersant.polarisMusic player for usage with a Polaris streaming server
First release: Jan 19, 2026
Polished Recognition com.georgernstgraf.polishedrecognitionVoice input for any keyboard — transcribe with your own API endpoints
First release: Sep 9, 2026
- Polish for AnySoftKeyboard com.anysoftkeyboard.languagepack.osspolish
First release: Jul 31, 2026
- Politrics eu.veldsoft.politrics
First release: Jul 31, 2026
PolyAlerts com.polyalertsFirst release: Oct 8, 2026
- < polycule > business.braid.polycule
First release: Aug 21, 2025
Polymarket Viewer com.streamatico.polymarketviewerFirst release: Jul 21, 2025
- Pomodoro tipz.pomodoro
First release: Nov 16, 2025
- pomodorot app.pomodorot
First release: Aug 6, 2025
- Pomozen org.projectsolutus.pomozen
First release: Sep 25, 2025
Portio com.portioOptimize batch cooking! Weigh meals and split portions based on each participant
First release: Apr 22, 2025
- Portuguese for AnySoftKeyboard com.anysoftkeyboard.languagepack.portuguese
First release: Jul 31, 2026
- pOT-Droid com.mde.potdroid
First release: Nov 8, 2025
Power Ampache 2 luci.sixsixsix.powerampache2First release: Feb 2, 2026
- Power Ampache 2 luci.sixsixsix.powerampache2.fdroid
First release: Oct 8, 2026
- POWheel net.kwatts.powtools
First release: Jun 24, 2020
- PPPPutSettings sk.henrichg.pppputsettings
First release: Jul 24, 2025
PPSSPP org.ppsspp.ppssppFirst release: Jul 24, 2025
Practice Suite com.berkersen.practicesuiteFirst release: Apr 11, 2025
- Praktika Vortaro com.esperantajvortaroj.app
First release: Jan 22, 2025
- Prav app.prav.client
First release: Jan 19, 2026
- Praxis com.jlucasgaldino.Praxis
First release: Nov 29, 2024
Prayer Book io.jozo.prayerbookCatholic prayers, rosary and litanies in 10 languages. Offline, no ads.
First release: Nov 25, 2025
- Prayer mode com.yahyaoui.prayermode
First release: Feb 10, 2026
- Prayer Time Muter com.prayertimemuter
First release: Jan 5, 2026
predikt io.github.hamdav.prediktFirst release: Jan 11, 2026
- Prepaid Balance com.github.muellerma.prepaidbalance
First release: Feb 17, 2025
PrepApp com.bunqr.prepapp.fdroidFirst release: Oct 2, 2025
Presence Publisher org.ostrya.presencepublisherRegularly publish to an MQTT topic
First release: Nov 25, 2025
Presencia com.shivangsagar.presenciaSimple offline attendance tracker for students
First release: Oct 11, 2026
Presents com.lezsoft.presentsFirst release: Jan 8, 2026
pretixPRINT eu.pretix.pretixprintFirst release: Oct 25, 2025
pretixSCAN eu.pretix.pretixscan.droidFirst release: Jul 19, 2019
- PReVo uk.co.busydoingnothing.prevo
First release: May 2, 2025
- Price Converter com.minimalisticapps.priceconverter
First release: Jan 13, 2024
- PriceGrab com.mablanco.pricegrab
First release: Jul 31, 2026
- Price Per Unit net.nitratine.priceperunit
First release: Apr 2, 2025
- primitive ftpd org.primftpd
First release: Dec 11, 2025
Principia com.bithack.principiaPhysics-based sandbox building game
First release: Apr 5, 2025
Print(Notes) com.printnotes.printnotesFirst release: Sep 15, 2025
Prism app.lonecloud.prismFirst release: Sep 10, 2026
- Prism File Explorer com.raival.compose.file.explorer
First release: Sep 12, 2025
- Privacify dev.robin.privacify
First release: Aug 3, 2026
Privacium com.kaleedtc.privaciumFirst release: Sep 21, 2025
- Privacy Browser com.stoutner.privacybrowser.standard
First release: Jul 31, 2026
- Privacy Cell com.stoutner.privacycell
First release: Jul 31, 2026
Privacy Flip io.github.dorumrr.privacyflipManage your device privacy based on lock/unlock state
First release: Jan 22, 2026
Privacy Kit Lite com.sal.privacykit.liteConfigure local privacy-related runtime hooks for LSPosed
First release: Oct 8, 2026
Privacy QR And Barcode Scanner com.laert.qrscannerFast, offline QR code and barcode scanner - no tracking, no ads
First release: Aug 27, 2026
- PrivacyScanner nodomain.xabd.privacyscanner
First release: Oct 28, 2025
PrivacyStats org.nlckysolutions.privacystatsFirst release: Nov 1, 2025
Privamatic com.techtrest.privamaticYour phone's privacy, scored 0–100. 50 checks, no internet permission.
First release: Aug 5, 2026
Private DNS Quick Setting com.flashsphere.privatednsqsFirst release: Sep 25, 2025
- Private DNS Quick Setting com.flashsphere.privatednsqs.nolauncher
First release: Oct 17, 2026
- Private DNS Quick Toggle ru.karasevm.privatednstoggle
First release: Aug 5, 2025
- Process Hook com.rifsxd.processhook
First release: Nov 1, 2024
ProcrastiLearn com.procrastilearn.appBlock distracting apps until you review a spaced-repetition flashcard
First release: Aug 19, 2026
Prog Metronome com.jayc180.rhythmengineFirst release: Jul 31, 2026
- ProgrammingTools com.example.programmingtools
First release: Dec 10, 2023
- ProgrammingTools com.programmingtools.app
First release: Apr 16, 2026
Project Asteria space.o4bit.projectasteria.fossA FOSS Android app for space exploration using official NASA APIs
First release: Aug 8, 2026
- ProseReader timur.prose
First release: Jan 6, 2026
- ProtectedWorkProfile protectedwp.safespace
First release: Aug 7, 2026
Protocol Berg Schedule info.metadude.android.protocolberg.scheduleFirst release: Oct 8, 2026
Proton Authenticator proton.android.authenticator.fdroidFirst release: Feb 7, 2026
Proton Calendar me.proton.android.calendarFirst release: Jan 14, 2026
- Proton Drive me.proton.android.drive
First release: Jan 14, 2026
Proton Pass proton.android.passFirst release: Feb 12, 2026
- Proton Pass proton.android.pass.fdroid
Password manager created by the scientists who met at CERN behind Proton Mail.
First release: Oct 1, 2025
Proton VPN ch.protonvpn.androidFirst release: Oct 7, 2024
Proton Wallet me.proton.wallet.androidFirst release: Mar 9, 2026
- Proxy Exit com.github.vgaj.proxy
First release: Jul 31, 2026
PSBDx SVN com.dev.svn.psbdxSubversion (SVN) client with biometric-locked credentials
First release: Oct 13, 2026
- PSLab io.pslab
First release: Sep 5, 2025
- psychphinder com.daih.psychphinder
First release: Dec 6, 2023
PsyJournal io.github.fseixaspt.psyjournalKeep track of substance usage to gain insights on consumption patterns
First release: Oct 17, 2026
- PTO - Plaintext Organizer de.ferreum.pto
First release: Sep 3, 2025
PublicArtExplorer com.zell_mbc.publicartexplorer.fossDiscover and view public art
First release: Aug 23, 2025
Pulsar ds.pulsarA simple BLE pulse meter (HRM - heart rate monitor) app +PiP.
First release: May 17, 2024
Pulse cc.zachy.pulseGarmin watch companion — your data stays on your phone
First release: Aug 16, 2026
- Pulse io.github.nyxar77.pulse
First release: Sep 16, 2026
Pulse partisan.weforge.xyz.pulseFirst release: Nov 2, 2026
Punch-hole Download Progress eu.hxreborn.phdpXposed module showing download progress around the camera cutout
First release: Feb 11, 2026
PuppyGit com.catpuppyapp.puppygit.play.proFirst release: Sep 17, 2025
Pure Link com.ahmedsamy.purelinkClean URLs, remove tracking, unshorten links & view history.
First release: Jan 7, 2026
- Pushie com.chesire.pushie
First release: May 30, 2024
Push Notifications API com.viktorholk.apipushnotificationsFirst release: Sep 14, 2024
- Puzzles name.boyle.chris.sgtpuzzles
First release: Sep 15, 2025
- pyLoad org.pyload.android.client
First release: Jul 31, 2026
- PySolFC org.lufebe16.pysolfc
First release: Oct 16, 2025
Qalculate! com.jherkenhoff.qalculatePowerful and versatile multi-purpose calculator
First release: Dec 22, 2025
qBitController dev.bartuzen.qbitcontrollerRemotely control qBittorrent from any device
First release: Sep 1, 2025
- QED eu.jonahbauer.qed.fdroid
First release: Oct 18, 2025
Qm Authenticator com.qmdeve.authenticatorAn open-source, secure, offline two-factor authentication application
First release: Nov 28, 2025
QOwnNotes org.qownnotes.mobileOffline Markdown notes synchronized safely with Nextcloud
First release: Oct 23, 2026
QRAlarm com.sweak.qralarmFirst release: Sep 13, 2025
QR Code Displayer app.cbdm.qrcodedisplayerReconstruct damaged or blurry QR codes entirely on-device for easy scanning.
First release: Oct 4, 2026
QRieux net.hilson.qrieuxQR scanner & creator. No ads, no tracking, works offline.
First release: Sep 23, 2026
QR Jukebox com.lennardhanss.qrjukeboxOffline audio player for QR-linked music. Ideal for music trivia board games.
First release: Oct 17, 2026
- QR Scanner com.secuso.privacyFriendlyCodeScanner
First release: Aug 2, 2025
QRServ dev.uint.qrservFirst release: Aug 16, 2025
QR share com.wchung.qrshareGenerate QR codes on share intent
First release: Dec 6, 2025
- QR warehouse askanimus.qrlager
First release: Nov 17, 2025
- qso-again de.qso.again
First release: Aug 2, 2026
QT Lab com.mv.qtlabInteractive quantum mechanics wave-function simulator.
First release: Oct 14, 2026
Quad9 Connect com.quad9.aegisFirst release: Aug 22, 2025
- Quadermas com.stypox.mastercom_workbook
First release: Jul 4, 2025
- QuandoInTV com.agatamessina.quandointv
First release: Jul 31, 2026
- Quasseldroid com.iskrembilen.quasseldroid
First release: Sep 3, 2026
Quedalle dev.mlg.quedalleFirst release: Oct 8, 2026
Queens com.sidhant.queensChallenging crown-placement logic puzzle. Infinite levels. No tracking & ads.
First release: Aug 9, 2026
Quest Log de.huppke.questlogFirst release: Oct 8, 2026
Quicall org.difft.temptalkSecure messaging with chat, voice and video calls.
First release: Aug 5, 2026
Quick Ball io.github.chayanforyou.quickballA Quick Action Ball that gives fast access to controls —volume, brightness, lock
First release: Aug 14, 2026
- Quick Calculation io.github.subhamtyagi.quickcalculation
First release: Aug 13, 2022
- QuickDic de.reimardoeffinger.quickdic
First release: Aug 22, 2025
QuickEdit com.abizer_r.quickeditBasic and lightweight Photo Editor.
First release: Aug 28, 2025
- QuickMDCapture com.example.quickmdcapture
First release: Jun 5, 2025
- QuickNotes io.github.patricksmill.quicknotes
First release: Jan 10, 2026
QuickNovel com.lagradost.quicknovelFirst release: Aug 8, 2025
- quickrotate info.plateaukao.quickrotate
First release: Apr 7, 2024
- QuickSE com.maazm7d.quickse
First release: Aug 21, 2025
Quick Search com.tk.quicksearchSearch apps, contacts, files, settings, calendar, and the web from one bar
First release: Jul 31, 2026
- Quick Settings Sound Profile com.curryplayer.quicksettingssoundprofile
First release: Aug 14, 2026
- QuickTiles com.asdoi.quicktiles
First release: Sep 12, 2025
QuickTile Settings com.rbn.qtsettingsFirst release: Feb 8, 2026
- Quick Timer com.shpak.quicktimer
First release: Aug 9, 2025
Quick UPI com.biohazard786.quickupiInstant UPI QR code generator via Quick Settings Tile. Fast, private.
First release: Jan 27, 2026
- QuickWeather com.ominous.quickweather
First release: Oct 23, 2025
Quiet Dial granularvolume.comFirst release: Aug 9, 2026
Quiet Grid com.quietgrid.appSudoku, Nonogram, Minesweeper, Word Search & more. No ads, fully offline.
First release: Aug 12, 2026
Quiet Rebellion net.quietrebellionFirst release: Aug 2, 2026
QUIK dev.octoshrimpy.quikFirst release: Mar 15, 2025
- QUIK dev.octoshrimpy.quik.fdroid
First release: Dec 11, 2025
Quillpad io.github.quillpadFirst release: Sep 19, 2025
Quinb xyz.deepdaikon.quinbA multiplayer reaction game: train your mind and your reflexes while having fun!
First release: Aug 26, 2024
Quire io.theficos.quireSelf-hosted EPUB reader for calibre-web. No telemetry, no cloud, your data.
First release: Jul 31, 2026
Quits nz.eloque.quitsQuits is a privacy-preserving expense splitting application
First release: Aug 14, 2026
Quitter com.quitter.appTrack quitting progress, milestones, journals, and recovery reminders.
First release: Jan 5, 2026
QuizFlow jdm.apps.quizflowFirst release: Mar 6, 2025
QuorumPony app.quorumponySplit a secret into printable cards. Any K of N recover it. Fully offline.
First release: Sep 20, 2026
- Quoter com.easwareapps.quoter
First release: Jul 31, 2026
- Quotes phone.vishnu.quotes
First release: Sep 4, 2025
Quotes.app com.shalenmathew.quotesappA minimalistic quotes app
First release: Feb 7, 2026
QuotesApp com.github.gouravkhunger.quotesappFirst release: Dec 3, 2024
Quote Unquote com.github.jameshnsears.quoteunquoteA Quotations / Affirmations App Widget
First release: Jun 22, 2025
Quran com.quran.labs.androidquranFirst release: Sep 21, 2025
QuranApp com.quranapp.androidread and explore the Holy Qur'an with multiple translations
First release: Jun 18, 2025
Qur'an Lite id.thony.android.quranliteFirst release: Sep 6, 2025
- Quran Majeed com.haseeb.quranapp
First release: Aug 3, 2026
Quran Revision Companion com.wqar.quran_mem_helperQuran for huffaz with mutashabihat(similar ayats) and mistake marking
First release: May 2, 2025
- Qwotable com.lijukay.quotesAltDesign
First release: Sep 18, 2024
- QZ Companion Nordictrack Treadmill org.cagnulein.qzcompanionnordictracktreadmill
First release: Jan 9, 2026
RaagaDB app.sudroid.raagadbFirst release: Sep 2, 2025
- Rabbit Escape net.artificialworlds.rabbitescape
First release: Mar 20, 2019
Raccoon com.livefast.eattrash.raccoonforfriendicaFirst release: Mar 4, 2025
- Raccoon com.livefast.eattrash.raccoonforlemmy.android
First release: Apr 6, 2025
- RacketGhost com.markusborg.test
First release: Aug 2, 2026
- RadarWeather org.woheller69.weather
First release: Jul 6, 2025
Radio România ro.radioromaniaactualitati.podcastsPlay the latest podcasts from Radio România.
First release: Oct 17, 2024
RadioUpnp com.watea.radio_upnpFirst release: Feb 10, 2026
- RadioWave org.onedroid.radiowave
First release: Apr 16, 2025
- RailTrip fr.nocle.passegares
First release: Jul 31, 2026
- Railway station photos de.bahnhoefe.deutschlands.bahnhofsfotos
First release: Jan 25, 2026
Rain com.yoshi.rainWeather application
First release: Nov 19, 2025
- Raise To Answer me.hackerchick.raisetoanswer
First release: May 18, 2024
- RakuRaku IME org.ghostsinthelab.app.rakurakuime
First release: Jul 31, 2026
- Ramblr com.trevornk.ramblr
Tap, ramble, tap. Clean dictated text lands wherever your cursor is.
First release: Sep 22, 2026
Randomix com.minar.randomixAn app to randomly choose between numbers, answers, options. 🃏
First release: Oct 12, 2026
- Randomly/Die ca.vaults.randomlydie
First release: Jul 31, 2026
Rank My Favs com.dessalines.rankmyfavsRank your favorite things, using simple pair-wise matchups.
First release: Sep 15, 2025
Ranobe org.ranobe.ranobeFirst release: May 23, 2025
- RapidSplit app.rapidsplit
First release: Aug 23, 2026
Ratafuel com.juliencardoux.ratafuelFind the cheapest fuel in France near you.
First release: Sep 29, 2026
Rattlegram com.aicodix.rattlegramTransmit short text messages over COFDMTV encoded audio signals
First release: May 5, 2025
- Raven kshib.raven
First release: Jun 28, 2024
Rayfish xyz.rayfish.androidFirst release: Sep 29, 2026
- Rayfish Dev xyz.rayfish.android.dev
First release: Aug 15, 2026
- rbtlui dev.bg.rbtlui
First release: Feb 6, 2025
- rC3 Schedule info.metadude.android.rc3.schedule
First release: Dec 30, 2020
ReadBear dev.tulis.readbearA cute&chill CBZ, PDF, EPUB reader that's ridiculously configurable!
First release: Sep 12, 2026
Readeck App de.readeckappFirst release: Nov 11, 2025
- Reader for Selfoss bou.amine.apps.readerforselfossv2.android
First release: Jul 31, 2026
Readest com.bilingify.readestFirst release: Sep 19, 2025
Read Later io.github.sak.read.it.laterBookmark. Read. Listen. The simple way to manage your reading list.
First release: Jul 30, 2026
ReadOut org.tawhid.readoutFirst release: Jan 15, 2025
Readrops com.readrops.appmulti-services RSS client
First release: Jul 7, 2025
Readwide com.readwide.managerLocal-first reader and file browser
First release: Jul 31, 2026
Read You me.ash.readerA modern and elegant RSS reader with Material You design
First release: Sep 2, 2025
ReallyBasicVocab de.herrmann_engel.rbvsimple flashcard app
First release: Jan 26, 2026
RealmScore de.morzo.realmscoreScore keeper for the Fantasy Realms card game
First release: Oct 2, 2026
- Rebooter com.github.girator.rebooter
First release: Dec 15, 2025
- RebootNya github.daisukikaffuchino.rebootnya
First release: Aug 3, 2026
Recents com.tymwitko.recentsLauncher-agnostic "Recents" menu for Android.
First release: Jul 30, 2026
Rechenzwerge de.happybuers.rechenzettelCounting and math practice for preschool and elementary school
First release: Oct 10, 2026
- reciper jdm.apps.reciper
First release: Jul 22, 2025
Reckoner finance.reckoner.appFirst release: Feb 9, 2026
- Reckoning Skills org.secuso.privacyfriendlyrecknoningskills
First release: Jan 2, 2025
RecollDroid org.grating.recolldroidFirst release: Nov 22, 2024
RECORDA de.uol.neuropsy.recordaFirst release: Oct 8, 2026
- RecordEqualizer com.sb.recordequalizer
First release: Sep 8, 2025
- RecorderX com.zygisk_enc.RecorderX
First release: Aug 3, 2026
- Recording Studio Lite io.github.leonidius20.recorder.lite
First release: Oct 25, 2024
Recording WebCam com.box.project.recording_appFirst release: Feb 21, 2024
RecordMaster com.pranshulgg.recordmasterRecording, Organizing, Sharing, and More
First release: Dec 5, 2025
Record Play Reverse me.proton.echophenomena.recordplayreverseFirst release: Nov 14, 2025
- Redomi com.acszo.redomi
First release: Nov 19, 2025
Redomi com.acszo.redomi.repoFirst release: Oct 7, 2026
RedReader org.quantumbadger.redreaderAn unofficial, open-source client for Reddit.
First release: Aug 26, 2024
- Red Screen org.vi_server.red_screen
First release: Aug 12, 2025
- RedTrigger com.redtrigger
First release: Jul 31, 2026
ReFra com.dot.galleryReFra — A modern, open-source media gallery
First release: May 14, 2025
Regex Crossword io.github.cuso4deposit.regexcrosswordOffline regex-crossword puzzles in hexagon and rectangle grids.
First release: Oct 2, 2026
- Regtest finance.valet.regtest
First release: Jul 31, 2026
Re:instead ru.hugeping.reinsteadFirst release: May 20, 2024
Rekado com.pavelrekun.rekadoFirst release: Aug 28, 2025
Relagent org.venkado.relagentFirst release: Sep 21, 2026
Relatrix com.saadibra.graymatterAn active knowledge-management and multi-modal note-taking platform.
First release: Aug 27, 2026
RelayPony com.relaypony.androidSend files phone to phone, encrypted end to end. No account, no cloud, no ads.
First release: Aug 12, 2026
RelaySMS com.afkanerd.sw0bFirst release: Aug 28, 2025
Reloado Auth com.reloado.authFirst release: Oct 8, 2026
Remail ink.hifuu.rusend_nextA clean, high-fidelity Gmail-inspired client for Resend.com.
First release: Oct 8, 2026
Remember dev.bikram.remember.ghFirst release: Jul 31, 2026
- Remember My Sort eu.hxreborn.remembermysort
First release: Jan 4, 2026
ReminDiary xyz.hub13.remindiaryOffline daily journal that surfaces what you wrote this day in past years
First release: Sep 16, 2026
Remind Me com.theissenmatthias.remind_meSimple reminders for the next 24 hours
First release: Oct 8, 2026
Remind Me! com.vishnu.remindmeFirst release: May 11, 2025
Remote Numpad com.guillaumepayet.remotenumpadThis application transforms your smartphone into a numpad for your computer.
First release: Oct 13, 2025
RemotePhone com.remotephoneMirror and control your Android phone from Linux over WiFi
First release: Sep 2, 2026
- RemotePointer systems.sieber.remotespotlight
First release: Jul 31, 2026
RemoteVideoCam org.avmedia.remotevideocamFirst release: Feb 3, 2026
Remote Wallpaper org.cssnr.remotewallpaperFirst release: Sep 5, 2026
Renamite org.mlm.renamiteMotion / vector animation editor
First release: Oct 12, 2026
Renkin dev.renkinProject.renkinMake your own icon pack, on your phone
First release: Aug 28, 2026
Repertoire io.github.adithya_jayan.myrepertoirapp.fdroidFirst release: Jan 26, 2026
- Repertoire io.github.adithya_jayan.myrepertoirapp.nightly
First release: Feb 1, 2026
RepForge com.devasy.repforgeWorkout logger with AI coaching, analytics & Health Connect integration
First release: Oct 9, 2026
Reply Radar com.rafaelfelipeac.replyradarFirst release: Aug 2, 2025
Repo Store com.samyak.repostoreDiscover, install, and update Android apps directly from GitHub releases.
First release: Feb 7, 2026
reReminder com.olaf.rereminderOpen-source recurring reminders, many timers, own schedules, no tracking.
First release: Nov 6, 2025
ReSearch com.example.researchDSL dictionary reader with fast search and DictZip support
First release: Aug 10, 2026
Resonance com.resonance.musicFirst release: Sep 26, 2026
- Restic de.lolhens.resticui
First release: Sep 9, 2024
- Resticopia org.dydlakcloud.resticopia
First release: Feb 22, 2026
Restoid io.github.hddq.restoidFirst release: Aug 4, 2026
- RestSMS net.xcreen.restsms
First release: Dec 27, 2024
ReteClock com.reteclockFull-screen digital clock and dock screensaver for old Android phones.
First release: Jul 31, 2026
ReteKey IME com.retekeyHangul keyboard with Esc, Tab, Ctrl and F-keys. 470 KB, one permission.
First release: Aug 11, 2026
ReTerminal com.rk.terminalTerminal Emulator
First release: Jun 10, 2025
- Retherm me.danb.retherm
First release: Oct 1, 2025
Rethink com.celzero.bravednsFirewall apps, use WireGuard VPN, monitor network, block malware, change DNS.
First release: Jun 9, 2024
RetoSwap com.retoswapFirst release: Oct 8, 2026
- RetroArch com.retroarch
First release: Nov 22, 2025
RetroDrawing com.github.msx80.retrodrawingA simple drawing app with big pixels and fixed palette.
First release: Nov 11, 2024
- Retro Music code.name.monkey.retromusic
First release: Oct 28, 2025
ReVanced Manager app.revanced.manager.flutterFirst release: Mar 24, 2026
Revengate org.revengate.revengateFirst release: Nov 21, 2024
- RevEngi org.revengi.app
First release: Aug 15, 2025
Reverb app.smallthingz.reverbRolling audio recorder for Android
First release: Aug 31, 2026
- Reykunyutsyìp com.kip.reykunyutsyip
First release: Sep 2, 2024
- RF Analyzer (FOSS) com.mantz_it.rfanalyzer
First release: Oct 25, 2025
RFM Radio com.vlad805.fmradioReal FM radio for rooted Qualcomm Android devices
First release: Mar 18, 2025
RHVoice com.github.olga_yakovleva.rhvoice.androidTTS engine with extended languages support (incl. Russian)
First release: May 2, 2025
- Rhythm chromahub.rhythm.app
Your Music, Your Rhythm - Privacy-first player with Material 3 design.
First release: Aug 20, 2025
Ricevapp Documento Commerciale com.giacomomensio.ricevappThird-party app for quick access, not affiliated with Agenzia delle Entrate
First release: Feb 1, 2026
Ricochlime com.adilhanney.ricochlimeFirst release: Sep 4, 2025
RidgeScout com.ridgebotics.ridgescoutFirst release: Oct 9, 2025
Ridm com.mremiyum.ridmappRidm is a powerful, open-source media download manager supporting 9 languages
First release: Oct 12, 2026
Riichi Mahjong Calculator io.ssttkkl.mahjongutils.appRiichi Mahjong Calculator, featuring hand efficiency calculation, and more.
First release: Jul 31, 2025
- RiMusic it.fast4x.rimusic
First release: Feb 22, 2025
Ringdroid org.thayyil.ringdroidAn application for creating your own ringtones.
First release: Feb 7, 2026
Ring-R com.hexcorp.ringrCreate custom ringtones from your favorite youtube videos
First release: Oct 8, 2026
RiPlay it.fast4x.riplayMultiplatform Music Player
First release: Feb 11, 2026
- Ripple info.guardianproject.ripple
First release: Oct 27, 2024
Riseup VPN se.leap.riseupvpnFirst release: Oct 8, 2026
- RKNHardering com.notcvnt.rknhardering
First release: Jul 31, 2026
- RoadEagle org.traffxml.roadeagle
First release: Jul 24, 2025
- RoadTripRadar ca.voiditswarranty.roadtripradar
First release: Jul 31, 2026
- Roaming Borders com.sleistikow.roamingborders
First release: Oct 15, 2025
Roaming Guard net.markuspetermann.roamingguardFirst release: Oct 8, 2026
- Robot36 xdsopl.robot36
First release: Nov 11, 2025
- Roboyard de.z11.roboyard
First release: Jan 20, 2026
Roc Droid org.rocstreaming.rocdroidFirst release: Jun 14, 2024
Rocinante com.ferlagod.rocinanteFast, private, and native client for the BookWyrm literary social network.
First release: Jul 31, 2026
Rocket.Chat chat.rocket.androidFirst release: Aug 31, 2026
- RomanDigital net.diffengine.romandigitalclock
First release: Jun 18, 2025
- Romanian for AnySoftKeyboard com.anysoftkeyboard.languagepack.romanian
First release: Jul 31, 2026
RoMote wseemann.media.romoteFirst release: Sep 23, 2025
- Root Checker foss.chillastro.root.checker
First release: Sep 20, 2026
Root Checker foss.chillastro.root.checker.offlineFirst release: Oct 26, 2026
RootlessJamesDSP me.timschneeberger.rootlessjamesdspSystem-wide JamesDSP audio processing engine for non-rooted Android devices.
First release: May 6, 2025
Rosarium at.krixec.rosaryAnimated rosary app with a focus on UX supporting multiple languages
First release: Jun 23, 2025
- RotationControl com.programminghoch10.RotationControl
First release: Jul 31, 2026
Roto org.rotoOffline rota and shift viewer with today/tomorrow focus, widget, zero tracking.
First release: Dec 7, 2025
Roue Libre io.github.mgdx.rouelibreBike sharing: offline map and journeys, with no tracker.
First release: Aug 29, 2026
Round Sync de.felixnuesse.extractA file manager for Android, using rclone for the heavy lifting.
First release: Sep 10, 2024
- Routine Tracker com.rendox.routinetracker
First release: Mar 15, 2024
- RowMate org.eagsoftware.rowmate
First release: Jul 31, 2026
Rowtine com.rowtine.appKnitting and crochet app: patterns, stash, counters. Offline and free.
First release: Sep 17, 2026
RPClient me.kafuuneko.rpclientAI roleplay chat and story writing client
First release: Aug 27, 2026
RPG NPC Generator me.kerooker.rpgcharactergeneratorFirst release: Aug 1, 2026
- RPN com.ath0.rpn
First release: Jun 12, 2024
- RSAF com.chiller3.rsaf
An Android Storage Access Framework document provider for rclone
First release: Feb 6, 2026
rsend invalid.lena.rsendPush phone folders to home SSH hosts with rsync over SSH
First release: Aug 19, 2026
- rssaid com.gmail.cn.leetao94.rssaid
First release: Dec 19, 2024
RSS Reader de.lolo.rssreaderCompact RSS reader with offline storage and background updates.
First release: Aug 2, 2026
Rsync for Tasker com.nerdoftheherd.tasker.rsyncFirst release: Jul 13, 2025
- Rsync Server com.github.ktsr42.rsyncserver
First release: Dec 18, 2025
Rtl-sdr driver marto.rtl_tcp_androPort of rtl-sdr's rtl_tcp
First release: Aug 11, 2024
RTranslator nie.translator.rtranslatorFirst release: May 17, 2025
RTSP IP-Cam Viewer com.github.warren_bank.rtsp_ipcam_viewerFirst release: Feb 4, 2026
- RTTT org.kirkezz.rttt
First release: Feb 27, 2025
Rubber Ring de.singular.looperA looper for practicing song parts.
First release: Jul 31, 2026
Rucoy calculator com.helloyanis.rucoycalculatorAn unofficial calculator for all things Rucoy Online related!
First release: May 9, 2025
Rue:barbe pl.telenczuk.counterappFirst release: Oct 8, 2026
- Ruffle rs.ruffle
An Android application for ruffle.rs
First release: Feb 9, 2026
Rufid io.github.rufidWrite and recover bootable USB media
First release: Oct 8, 2026
- Ruler org.secuso.privacyfriendlyruler
First release: Jul 31, 2026
- Ruler org.secuso.privacyfriendlyrulerapp
First release: Jul 14, 2025
RunnerUp org.runnerupRunnerUp - an open source GPS tracker with advanced workout and audio cues.
First release: Sep 8, 2024
- RunnerUp org.runnerup.free
First release: Jul 31, 2026
Running Services Monitor me.biplobsd.rsmMonitor running services on your Android device with Root or Shizuku
First release: Feb 10, 2026
- ruNNNpe bridge com.zappbrannigan34.runnnpebridge
First release: Jul 31, 2026
Rush com.shub39.rushApp to search, view and share lyrics
First release: Jan 27, 2026
Rush Hour com.sphericalkat.rushhourFirst release: Oct 8, 2026
Ruslin org.dianqk.ruslinA note application that supports syncing using a self-hosted Joplin server.
First release: Sep 22, 2024
- Russian for AnySoftKeyboard com.anysoftkeyboard.languagepack.russian2
First release: Jul 31, 2026
RustDesk com.carriez.flutter_hbbAn open-source remote desktop application, the TeamViewer alternative
First release: Sep 15, 2025
rust-keylock org.astonbitecode.rustkeylockFirst release: Nov 26, 2025
- Rusyn for AnySoftKeyboard com.anysoftkeyboard.languagepack.rusyn
First release: Jul 31, 2026
RUTEdu prz.rutedu.appInteractive education app for chemistry, math and geography
First release: Oct 8, 2026
- RUTMath com.octbit.rutmath
First release: Sep 23, 2025
- RvKernel Manager com.rve.rvkernelmanager
First release: Sep 12, 2025
- RvKernel Manager com.rve.rvkernelmanager.beta
First release: Nov 14, 2025
RvSystem Monitor com.rve.systemmonitorHigh-performance system monitoring for Android.
First release: Aug 12, 2026
RWR io.github.revocx35.rwrWarns you when someone behind you looks at your screen (shoulder surfing)
First release: Oct 13, 2026
RZR bilalsul.rzrBeautifully made mobile code and markdown reader.
First release: Sep 3, 2026
- S2MSP com.github.frimtec.android.securesmsproxy
First release: Sep 17, 2025
Saber com.adilhanney.saberFirst release: Aug 18, 2025
Sable moe.sable.clientFirst release: Oct 2, 2026
Safe Haven com.colourswift.safehavenFirst release: Jul 31, 2026
Safe Space org.privacymatters.safespaceA safe space for your digital valuables.
First release: Jan 10, 2026
SAF Media Scanner de.kromke.andreas.safmediascannerAuxiliary program for the "Unpopular Music Player" and "Opus 1 Music Player"
First release: Sep 3, 2025
Salmon net.dege.salmonFirst release: Sep 3, 2026
- Salmon Tracker com.tripperdee.salmontracker
First release: Sep 11, 2026
- Salty com.vauth.salty
First release: Jul 29, 2026
SambaLite de.schliweb.sambaliteFirst release: Sep 17, 2025
- Same de.mlex.same
First release: Jan 26, 2024
- SanskritBasicsLetters com.sanskritbasics
First release: Aug 12, 2024
- Sapfir org.codeberg.nykula.sapfir
First release: Jul 15, 2025
Sapio com.klee.sapioAndroid apps that respect you!
First release: Feb 10, 2026
- Saracroche com.cbouvat.android.saracroche
First release: Nov 27, 2025
- Sardinian for AnySoftKeyboard com.anysoftkeyboard.languagepack.sardinian
First release: Jul 31, 2026
SatDump org.satdump.SatDumpA generic satellite data processing software.
First release: Nov 29, 2024
- SatStat com.vonglasow.michael.satstat
First release: Apr 22, 2025
Satunes io.github.antoinepirlot.satunesSatunes is a mp3 player developed by an organic intelligence.
First release: Nov 20, 2025
- Satunes (test) io.github.antoinepirlot.satunes.test
First release: Jan 13, 2026
- SatWorth com.example.satworth
First release: Jun 12, 2024
SauceNAO com.luk.saucenaoUnofficial SauceNAO client.
First release: Apr 7, 2025
- Save name.lmj001.savetodevice
First release: May 24, 2023
Save net.opendasharchive.openarchive.releaseSafely preserve, organize, and share your mobile media
First release: Sep 19, 2025
Save Locally com.mateusrodcosta.apps.share2storageUsing an app that doesn't allow Saving but allows Sharing? No problem!
First release: Jun 5, 2025
- SaverTuner s1m.savertuner
First release: Jun 25, 2025
- Save to… xyz.myachin.saveto
First release: Jul 31, 2026
Sav PDF Viewer com.saverio.pdfviewerFirst release: Aug 6, 2025
Sayboard com.elishaazaria.sayboardAn open-source on-device voice IME (keyboard) for Android using the Vosk library
First release: Aug 23, 2024
SayWhen com.dmi3dmi3.saywhenOne phrase — and it's on your calendar. No forms, no fields.
First release: Aug 13, 2026
- SBW com.btcontract.wallet
First release: Jul 31, 2026
- ScaleLauncher de.pritcloud.scalelauncher
Use Xiaomi S400 locally via Bluetooth with openScale and Health Connect
First release: Oct 4, 2026
- Scale Practice com.scalepractice
First release: Dec 28, 2024
ScanBridge io.github.chrisimx.scanbridgeFirst release: Dec 30, 2024
SCEE de.westnordost.streetcomplete.expertFirst release: May 27, 2025
ScenePeek com.divinelink.scenepeekTMDB & Seerr for Android
First release: Aug 1, 2026
SchildiChat de.spiritcroc.riotxFeature-rich messenger for Matrix based on Element with some extras and tweaks
First release: Mar 16, 2026
- SchildiChat Next chat.schildi.android
First release: Mar 22, 2026
Schmackofatz space.pleura.schmackofatzAn app to view the meal plan at Leipzig's univeristies.
First release: Nov 10, 2025
- Schulrechner io.cardijey.schulrechner
First release: Sep 7, 2025
Schussel org.bitsrc.schusselBluetooth-triggered checklists that remind you of what you forgot.
First release: Sep 2, 2026
- Scoreboard com.github.vatbub.scoreboard
First release: Jun 3, 2024
scorecounter org.pichove.scorecounterA simple score counting app
First release: Oct 8, 2026
Score Counter es.hegocre.scorecounterSimple app to keep track of two scores
First release: Aug 27, 2025
ScoreHub com.github.trivialloop.scorehubTrack your board game scores easily
First release: Jul 30, 2026
Scrambled Exif com.jarsilio.android.scrambledeggsifRemove the metadata from your pictures before sharing them
First release: Apr 9, 2025
Scratchpad Launcher app.scratchpad.launcherA minimal launcher with an always-visible scratchpad. Zero ads.
First release: Sep 23, 2026
scrcpy invalid.lena.scrcpyMirror a second Android device over wireless ADB. No root required.
First release: Aug 14, 2026
ScrcpyForAndroid org.client.scrcpymirror display and touch control between Android devices
First release: Aug 29, 2025
Screenlite Web Kiosk org.screenlite.webkioskdisplays web content in full-screen mode
First release: Sep 23, 2025
- Screen Lock com.tiendnm.zukulock
First release: Jun 17, 2025
Screen Off Timer com.inod.screenofftimerFirst release: Oct 8, 2026
Screen Recorder com.haseeb.recorderFirst release: Sep 9, 2026
- Screenshot Tile com.github.cvzi.screenshottile
First release: Dec 2, 2025
- ScreenStream info.dvkr.screenstream
First release: Jan 25, 2026
Screen Time com.atharok.screentimeEasily track the time you spend on your device and apps.
First release: Sep 8, 2025
- Screen Time com.soberdigital.screentimetracker
First release: Apr 23, 2025
Screen Time de.markusfisch.android.screentimeDisplay your screen time in a permanent notification
First release: Aug 5, 2025
Screw Jam com.sidhant.screwjamUnscrew plates, match colors with active toolboxes
First release: Sep 3, 2026
- Scrib dev.thaulow.scrib
First release: Aug 1, 2026
Scrib org.scrib.transcriberOn-device voice transcription. Your audio never leaves your phone.
First release: Oct 14, 2026
- Scribe4 eu.veldsoft.scribe4
First release: Sep 16, 2025
- Script Runner for Termux io.github.swiftstagrime.termuxrunner
First release: Aug 25, 2026
Scroll Block com.vishal2376.scrollblockFirst release: Jun 25, 2024
ScrubPony com.norsehorse.scrubponyStrip GPS and metadata from JPEG, PNG, WebP and HEIC photos, on your device.
First release: Sep 22, 2026
SDAI FOSS com.shifthackz.aisdv1.app.fossOpen-source Stable Diffusion client for Android and iOS workflows.
First release: Apr 5, 2025
- SDAI Full com.shifthackz.aisdv1.app.full
Open-source Stable Diffusion client for Android and iOS workflows.
First release: Apr 5, 2025
- SDB Viewer org.zephyrsoft.sdbviewer
First release: Aug 29, 2025
SDK Monitor com.bernaferrari.sdkmonitorDisplay and monitor the targetSDK from installed apps
First release: Dec 27, 2025
SD Maid SE eu.darken.sdmseFirst release: Sep 19, 2025
Seafile com.seafile.seadroid2File synchronization
First release: Jan 23, 2026
Seal com.junkfood.sealFirst release: Oct 16, 2024
- Seal Preview com.junkfood.seal.preview
First release: Nov 29, 2024
Seamless org.woheller69.seemlessOffline speech to text translator
First release: Sep 23, 2025
- SearchLauncher com.searchlauncher.app
Search apps, contacts and the web, and open results in an ad-free browser
First release: Aug 13, 2026
searxist xyz.linerly.searxistSearch with SearXNG natively on Android.
First release: Feb 2, 2026
Secluso com.secluso.mobileFirst release: Oct 8, 2026
- SecondScreen com.farmerbb.secondscreen.free
First release: Sep 14, 2024
- SecureOTP com.otpextractor.secureotp
First release: Oct 9, 2025
Secure QR Share com.revold1985.secureqrshareShare passwords and links securely via encrypted QR codes.
First release: Oct 8, 2026
SecureScreen com.securescreen.appProtect selected apps from screenshots and screen recording
First release: Jul 31, 2026
Seeker com.companyname.andriodapp1First release: Mar 5, 2024
- Seek Privacy com.seeker.seekprivacy
First release: Jan 4, 2026
Seenema: Movie Tracker sitavi.seenemaTrack and rate the films and series you have watched. No account, no ads.
First release: Aug 11, 2026
- Seers Lodge chat.seers.app
First release: Feb 22, 2025
- Sefaria org.sefaria.sefaria
First release: Jul 20, 2023
Sefirah com.castle.sefirahFirst release: Feb 6, 2026
- Sehat com.rouf.saht
First release: Aug 23, 2026
- Select Text to Search me.zhanghai.android.textselectionwebsearch
First release: Jul 2, 2025
SelfPrivacy pro.kherel.selfprivacyFirst release: Aug 10, 2026
sensagram com.github.umer0586.sensagramStream Android sensor data over UDP with minimal latency.
First release: Dec 8, 2025
- Senslogs fr.inria.tyrex.senslogs
First release: Oct 5, 2025
- Sensorkraken org.sensorkraken
First release: Apr 22, 2024
- Sensors2OSC org.sensors2.osc
First release: Dec 20, 2025
SensorServer github.umer0586.sensorserverStream phone's sensors to websocket clients
First release: Feb 4, 2026
- Sensor Spot com.github.umercodez.sensorspot
First release: Feb 11, 2026
Sente - Online GO io.zenandroid.onlinegoFirst release: Sep 19, 2025
Sentinel com.samourai.sentinelFirst release: Aug 8, 2025
Sentinel Lens com.fpf.sentinellensFacial recognition surveillance with alerts
First release: Apr 26, 2025
- Seqular net.seqular.network
First release: May 5, 2025
- Serbian for AnySoftKeyboard com.anysoftkeyboard.languagepack.serbian_oss
First release: Jul 31, 2026
- SerialTest priv.wh201906.serialtest
First release: Apr 18, 2024
ServeIt com.example.flutter_http_serverFirst release: Apr 20, 2024
ServerBox tech.lolli.toolboxA server status & toolbox app using Flutter
First release: Sep 14, 2025
Service Browser com.druk.servicebrowserFirst release: Oct 7, 2026
Session network.loki.messengerFirst release: Oct 14, 2024
Session F-Droid network.loki.messenger.fdroidEncrypted private messenger
First release: Oct 14, 2026
- Setter site.leos.setter
First release: Jul 30, 2024
Settings Database Editor io.github.muntashirakon.seteditOpen source version of the 4A Settings Database Editor
First release: Mar 9, 2024
Setwork com.designlife.justdoFirst release: Aug 6, 2026
SexyTopo org.hwyl.sexytopoFirst release: Jan 30, 2026
SFTP Documents Provider lu.knaff.alain.saf_sftpBrowse SFTP server in your file manager
First release: Jan 25, 2026
Shader Editor de.markusfisch.android.shadereditorFirst release: Aug 26, 2025
- ShadowQUIC Plugin com.github.dyhkwong.sagernet.plugin.shadowquic
First release: Feb 16, 2026
- Shadowsocks com.github.shadowsocks
First release: Feb 10, 2026
Shadowsocks com.github.shadowsocks.tvFirst release: Oct 8, 2026
- Shake Alarm Clock in.basulabs.shakealarmclock
First release: Feb 24, 2024
- Share 2 Archive Today org.gnosco.share2archivetoday
First release: Nov 1, 2025
- ShareAsQR com.github.mikulash.shareasqr
First release: Aug 28, 2025
SharedHaven com.bitcoin.sharedhaven.testnetFirst release: Nov 22, 2025
- ShareFileServer com.xlzhen.sharefileserver
First release: Sep 23, 2022
Share Paste O2 alt.nainapps.sharepasteFirst release: Jan 19, 2026
Share Paste O2 alt.nainapps.sharepaste.fdroidFirst release: Oct 7, 2026
Share to Folder lu.knaff.alain.share_to_folderShare data from other apps to a folder
First release: Feb 10, 2026
- Share To InputStick me.hackerchick.sharetoinputstick
First release: Nov 20, 2025
- Share via HTTP com.MarcosDiez.shareviahttp
First release: Jan 4, 2026
ShareX com.akansh.sharexFirst release: Oct 9, 2026
sharing com.ammar.sharingShare files and apps via browser with a solution to apps with multiple APK files
First release: Nov 2, 2024
SharkDroid org.sharkdroidCapture and analyze network packets with Wireshark tools on Android
First release: Oct 11, 2026
Sheepy Horn com.mendhak.sheepyhornPlays the "wah wah waaah" sound. Use this when someone tells a bad joke.
First release: Oct 8, 2026
- Shelf com.coleblvck.shelf
First release: Jun 26, 2024
Shelf dev.tn3w.shelfOffline book catalogue: search, track streaks, read your own files.
First release: Oct 4, 2026
Shelf io.github.melastore.shelfHide folders instantly behind a working decoy app. Root optional.
First release: Oct 17, 2026
ShelfDroid dev.halim.shelfdroidAudiobookshelf Android client with playback, downloads, and server management
First release: Aug 5, 2026
Shellwave io.github.lordofpolls.shellwaveOpen-source SSH client and terminal with SFTP, port forwarding and jump hosts
First release: Sep 20, 2026
- SherpaTTS org.woheller69.ttsengine
First release: Sep 26, 2025
Sherpr org.sherpr.appDrive your Herdr AI-agent fleet from your phone, over SSH — no cloud
First release: Sep 18, 2026
ShiftSwift de.nulide.shiftcalFirst release: Oct 1, 2024
Shikaku com.sidhant.shikakuA minimalist block logic puzzle game
First release: Sep 18, 2026
ShikiApp org.application.shikiappUnofficial Shikimori mobile app
First release: Sep 13, 2025
Shiori com.desarrollodroide.pagekeeperAndroid client for the Shiori Bookmark Manager
First release: Feb 11, 2026
ShizuCallRecorder com.kitsumed.shizucallrecorderEmpowers ADB through Shizuku to record phone calls on non-rooted device!
First release: Aug 1, 2026
Shizuku moe.shizuku.privileged.apiFirst release: May 25, 2025
ShizuStore me.timschneeberger.shizustoreApp store for Shizuku apps that installs APKs from their upstream sources.
First release: Sep 21, 2026
ShizuWall com.arslan.shizuwallLightweight no root, no vpn firewall solution powered by Shizuku
First release: Aug 2, 2026
ShockAlarm de.computerelite.shockalarmMaterial3 app for controlling OpenShock shockers
First release: Feb 9, 2026
ShoppingList pl.edu.pjwstk.s999844.shoppinglista simple shopping list application
First release: Oct 22, 2025
- Shopping List com.jaimegonzalezfabregas.shoppinglist
First release: Sep 9, 2025
- Shopping List com.wbpxre150.shoppinglist
First release: Nov 10, 2025
- Shopping List privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist
First release: Jul 30, 2025
Shopping List Calculator io.github.buildsbyben.shoppinglistcalcPlan your grocery trips, add up costs, and keep track of your budget.
First release: Aug 28, 2026
Shopping List for Nextcloud dev.otherworld.shoppinglistA fast, offline-friendly shopping list that syncs with your Nextcloud server.
First release: Aug 10, 2026
Shopt eu.domob.shopt2A simple shopping list app with shop grouping and item ordering.
First release: Dec 29, 2025
- Shop with mom org.jdfossapps.android.shopwithmom
First release: Jul 31, 2026
Shosetsu app.shosetsu.android.fdroidFirst release: Oct 7, 2026
Shots Studio com.ansah.shots_studioFirst release: Sep 21, 2025
- ShowCase com.wirelessalien.android.moviedb
First release: Jul 31, 2026
- ShowCase Plus com.wirelessalien.android.moviedb.full
First release: Sep 14, 2025
- Showly com.michaldrabik.showly2
First release: Dec 21, 2025
Shredpix com.aicodix.shredpixA coded OFDM update to SSTV to send images digitally over SSB, AM and FM radio
First release: Nov 13, 2025
ShutApp fr.s2009.shutappFirst release: Oct 8, 2026
- SicMu Neo xyz.mordorx.sicmu
First release: Mar 16, 2026
- SicMu Player souch.smp
First release: Jul 31, 2026
Sideband io.unsigned.sidebandFirst release: Nov 25, 2024
SideDeck es.manifold.sidedeckFree DJ app. Mix on your phone. No subscriptions.
First release: Aug 27, 2026
- Sidestep com.blankdev.sidestep
First release: Feb 6, 2026
Sift app.siftrecipesFirst release: Jan 19, 2026
Sigil dev.animeshvarma.sigilOpen-source zero-trust cryptography & privacy suite with multi-layer encryption.
First release: Jan 30, 2026
Signal org.thoughtcrime.securesmsFirst release: Sep 18, 2025
- Signal Generator org.billthefarmer.siggen
First release: Aug 2, 2026
- SignalSense com.signalsense.app
First release: Aug 3, 2026
- SignalTrackWriter truewatcher.signaltrackwriter
First release: Nov 10, 2024
Signet dev.digitalgrease.signetVerify calls from family, colleagues, sources against deepfake impersonation.
First release: Oct 25, 2026
Silence me.lucky.silenceBlock unknown callers
First release: Nov 30, 2025
SilentNotes ch.martinstoeckli.silentnotesNote taking app with optional end-to-end encrypted sync to your PC.
First release: Sep 16, 2025
SilentShare com.github.normplum.silentshareFirst release: Oct 8, 2026
Silicone Calculator ir.erfansn.siliconecalculatorFirst release: Dec 12, 2025
SilverDict com.gmail.blandilyte.silverdictFirst release: Jun 18, 2024
- SimbaDroid de.buttercookie.simbadroid
First release: Oct 21, 2025
- Simlar org.simlar
First release: Jul 28, 2025
Simple tr.com.basarsubasi.simplefitnessappFirst release: Aug 22, 2025
Simple Audio Converter com.technicjelle.simple_audio_converterFirst release: Aug 23, 2026
Simple Calorie Tracker com.antomanc.simplecalorietrackerFirst release: Jan 21, 2025
- Simple Clipboard Editor com.trianguloy.clipboardeditor
First release: Sep 23, 2025
- Simple Counter org.quicksc0p3r.simplecounter
First release: Oct 10, 2024
Simple Crypto Widget com.brentpanther.bitcoinwidgetA simple widget to display prices for lots of cryptocurrencies.
First release: Jun 29, 2025
SimpleDay de.mymiggi.simpledayMinimalist Markdown diary with app lock and your-own-cloud WebDAV sync.
First release: Aug 11, 2026
Simple File Manager me.jaival.filesFirst release: Sep 15, 2026
- SimpleFrame com.louissimonmcnicoll.simpleframe
First release: Jun 20, 2025
simple-gym-logger com.anonymous.simplegymloggerFirst release: Jan 3, 2025
SimpleHIIT fr.shiningcat.simplehiitCustomisable HIIT timer with animated exercises
First release: Sep 11, 2026
Simple Keyboard rkr.simplekeyboard.inputmethodFirst release: Sep 18, 2025
- SimpleLogin io.simplelogin.android.fdroid
First release: Jul 1, 2024
- Simple Markdown com.wbrawner.simplemarkdown
First release: Feb 22, 2021
Simple Markdown com.wbrawner.simplemarkdown.freeA simple markdown editor
First release: Aug 23, 2026
Simple Money Tracker com.xvzan.simplemoneytrackerYet another personal accounting app
First release: Jul 11, 2025
Simple Nextcloud de.nielstron.simplenextcloudA small Nextcloud file browser without a duplicate upload cache
First release: Sep 21, 2026
- Simplenote com.automattic.simplenote
First release: Aug 18, 2025
Simple Notes dev.dettmer.simplenotesOffline notes & checklists, self-hosted sync. Under 5 MB, no ads, no tracking.
First release: Feb 10, 2026
- Simple QR com.tomfong.simpleqr
First release: Aug 27, 2025
Simple Quiz FR com.crazyunicorn.simplequizfrFirst release: Feb 4, 2026
- Simple Raw Camera com.dan.simplerawcamera
First release: Dec 28, 2024
- Simple Reboot simple.reboot.com
First release: Apr 6, 2024
- SimpleReminder felixwiemuth.simplereminder
First release: Dec 1, 2025
- Simple Remote com.iiordanov.HakkoSimpleRemoteVnc
First release: Apr 30, 2026
- Simple Search de.tobiasbielefeld.searchbar
First release: Feb 10, 2026
Simple Song Collector com.open.simplesongfindergather YouTube audio tracks
First release: Jan 27, 2026
- Simplest Notes com.traseapps.simplestNotes
First release: Jul 24, 2025
SimpleTag dev.secam.simpletagTag your audio files
First release: Jan 2, 2026
- SimpleTextCrypt com.aidinhut.simpletextcrypt
First release: Dec 29, 2015
- Simple Text Editor com.maxistar.textpad
First release: Feb 1, 2026
Simple Time Tracker com.razeeman.util.simpletimetrackerFirst release: Aug 30, 2025
SimpleTune com.samyak.simpletubeFirst release: Oct 8, 2026
SimpleX chat.simplex.appSimpleX Chat - e2e encrypted messenger without any user IDs - private by design!
First release: Sep 8, 2025
SimpleXray com.simplexray.anA simple, fast Xray client
First release: Feb 6, 2026
Simply Scored com.fpuellen.simplyscoredFirst release: Oct 8, 2026
SimplyTranslate Mobile com.simplytranslate_mobileA privacy friendly frontend to Google Translate
First release: Apr 12, 2024
SimpMusic com.maxrave.simpmusicA simple music app using YouTube Music for backend
First release: Aug 31, 2025
SimRa de.tuberlin.mcc.simra.appFirst release: Feb 22, 2024
Since Us app.sinceusCount your days together. Private, ad-free and made for every kind of love.
First release: Oct 11, 2026
- sing-box io.nekohasekai.sfa
First release: Feb 9, 2026
- Sinhala for AnySoftKeyboard com.anysoftkeyboard.languagepack.sinhala
First release: Jul 31, 2026
Sipdroid org.sipdroid.sipuaFirst release: Jul 1, 2024
- SIS io.github.sykoram.sis
First release: Aug 10, 2024
Sitemarker io.github.aerocyber.sitemarkerAn elegant bookmark manager
First release: Aug 15, 2025
- Siteswap Generator namlit.siteswapgenerator
First release: Feb 8, 2026
- Sithakuru sithakuru.sinhala.keyboard
First release: Sep 11, 2026
- Six Shooter dk.dustytales.sixshooter
First release: Jul 31, 2026
SiYuan org.b3log.siyuanOpen-source knowledge workspace for humans and AI agents
First release: Jan 27, 2026
- Sketches org.secuso.privacyfriendlysketching
First release: Sep 4, 2025
- SkillApp com.theskillapp.skillapp
First release: Oct 13, 2025
- SkillTRack in.gururaja.skillrack
First release: Jul 14, 2025
- SkinBread zatrit.skinbread
First release: Jul 29, 2024
Skylib dev.bg.skylibAn alternative Bluesky frontend
First release: Aug 4, 2026
Skylight Wallet org.magicgrants.skylightA Monero light-wallet
First release: Sep 21, 2026
Sky Map com.google.android.stardroidSky Map turns your phone into a window on the night sky.
First release: Jan 27, 2025
SkyPulse io.github.mrjohn6774.skypulseDecode and monitor 1090 MHz ADS-B aircraft with an RTL-SDR
First release: Sep 20, 2026
- SkyTube free.rm.skytube.oss
First release: Aug 31, 2025
- SkyTube Extra free.rm.skytube.extra
First release: Aug 31, 2025
- SkyTube Legacy free.rm.skytube.legacy.oss
First release: Jan 28, 2026
Slate com.braniik.slateMinimal customisable launcher. A blank slate where your apps go anywhere.
First release: Sep 3, 2026
Slate com.slate.launcherMinimal text-only Android home screen. No icons. No analytics. Zero network.
First release: Aug 17, 2026
- Slauncher app.slauncher
First release: Jan 19, 2026
- Slauncher com.s4nj1th.slauncher
First release: Aug 17, 2026
SleepGuard com.sleepguardLocks your phone when you fall asleep watching videos. No ads, open source.
First release: Sep 4, 2026
- SleepTimer com.sleeptimer
First release: Jan 7, 2026
SleepTimer dev.xitee.sleeptimerAudio fade-out and screen lock at the end of a countdown. No ads, no internet.
First release: Aug 25, 2026
- Sleep Timer fr.smarquis.sleeptimer
First release: Nov 28, 2025
- Slideshow Screensaver com.github.warren_bank.slideshow_screensaver
First release: Aug 3, 2026
- Slideshow Wallpaper io.github.doubi88.slideshowwallpaper
First release: Aug 26, 2025
SlimBook uk.org.retallack.slimbookClean, ad-free Facebook feed with real-time content filtering
First release: Sep 9, 2026
SlimSocial for Facebook it.rignanese.leo.slimfacebookBrowse Facebook
First release: Apr 6, 2025
Slitherlink com.sidhant.slitherlinkConnect the dots to form a single continuous loop. Pure, relaxing logic puzzle.
First release: Sep 28, 2026
Slooop io.dashchan2Imageboard client for Android 11+
First release: Sep 11, 2026
- Slovak for AnySoftKeyboard org.herrlado.ask.languagepack.slovak
First release: Jul 31, 2026
- Slovene for AnySoftKeyboard com.anysoftkeyboard.languagepack.slovene
First release: Jul 31, 2026
Slow Mail com.theripper.slowmailFirst release: Oct 8, 2026
- Smart Card Emulator com.vsmartcard.acardemulator
First release: Sep 11, 2026
- Smart Card Reader com.vsmartcard.remotesmartcardreader.app
First release: Dec 4, 2024
Smart Dock cu.axel.smartdockA user-friendly desktop mode launcher that offers a modern and customizable user interface
First release: May 9, 2023
- Smart Edge com.imi.smartedge.sidebar.panel
First release: Jul 31, 2026
- Smart EggTimer org.woheller69.eggtimer
First release: Sep 29, 2025
SmartFind com.smartfind.appFind your phone with an SMS from a trusted contact
First release: Oct 31, 2026
- SmartMouse ch.virt.smartphonemouse
First release: Aug 1, 2024
Smart Radio Telescope eu.radio_science_institute.smart_radio_telescopeFirst release: Aug 23, 2026
SmartScan com.fpf.smartscanFirst release: Aug 19, 2026
Smartspacer com.kieronquinn.app.smartspacerFirst release: Sep 20, 2025
SmartTube org.smarttube.stableFirst release: Aug 7, 2026
SmartTube F-Droid app.smarttube.fdroidBrowse media content with your own rules on Android TV
First release: Oct 25, 2026
SmartVoice tts.smartvoiceMultilingual speech synthesis
First release: Oct 3, 2026
- SMASH eu.hydrologis.smash
First release: Jan 20, 2026
- Smile the slime com.spacestation14.Smile
First release: May 18, 2025
- Smither org.nuclearfog.smither
First release: Nov 9, 2025
- Smoke org.purple.smoke
First release: Jun 24, 2024
SmokingYou com.smokingtrackerMinimalist, data-oriented smoking tracker with analytics, widgets, and themes.
First release: Aug 11, 2026
SmolChat io.shubham0204.smollmandroidFirst release: Sep 19, 2025
- Smouldering Durtles com.smouldering_durtles.wk
First release: Feb 1, 2025
- Sms2Call dev.n4n5.sms2call
First release: Feb 11, 2025
SMS2Email io.github.sms2email.sms2emailFirst release: Feb 12, 2026
SMSecure org.jimvixx.smsecurePrivacy-focused SMS app with encrypted conversations
First release: Aug 26, 2026
- Sms Forwarder tech.bogomolov.incomingsmsgateway
First release: Apr 28, 2024
- SMS Forwarding com.github.warren_bank.sms_automatic_forwarding
First release: Feb 11, 2026
SMSGate me.capcom.smsgatewayFirst release: Mar 19, 2026
SMS Import / Export com.github.tmo1.sms_ieImports and exports SMS and MMS messages and other data.
First release: Sep 9, 2025
- SmsLoc io.github.wandomium.smsloc
First release: Sep 19, 2025
- SMS Reply hu.kadatsoft.smsreply
First release: Dec 30, 2025
- SMS Shield ski.wischnew.shield
First release: Aug 5, 2026
SMS Telebot com.teslor.sms_telebotFirst release: Sep 23, 2026
Snakes red.drugi.snakesMake your way through an extended version of Snake with computer-controlled opponents.
First release: Aug 10, 2025
Snapcast de.badaix.snapcastSnapcast client for Android
First release: Dec 2, 2024
SnapSafe com.darkrockstudios.app.securecameraSnap pics of anything, safely.
First release: Sep 25, 2025
SnapSaver lying.fengfeng.snapsaverFirst release: Dec 23, 2025
- Snaptick com.vishal2376.snaptick
First release: Apr 16, 2025
Snikket org.snikket.androidFirst release: Jan 25, 2026
- Snore Detector com.aistudio.snoredetector.afkwd
First release: Aug 4, 2026
- sNotz com.sunilpaulmathew.snotz
First release: Aug 23, 2025
- Snow org.baitmooth.snow
First release: Aug 11, 2024
- Snow Black org.baitmooth.snow.light
First release: Jun 12, 2026
Snowdrop site.remlit.snowdropMultiplatform client for Mastodon API compatible fediverse software
First release: Jul 28, 2026
Snowflake io.bloco.snowflakeHelp people in censored countries access the Internet without restrictions
First release: Aug 10, 2026
SnowRaven com.dtgibson.snowravenBirding tools and data explorer for your eBird and Macaulay Library exports
First release: Oct 11, 2026
Sobuu com.sobuumedia.sobuuTrack books reading and organise your readings
First release: Dec 1, 2025
- Social Deduction Game io.github.jens_3.socialdeductiongame
Offline game-master assistant for Werewolf, Mafia and social deduction games
First release: Sep 21, 2026
SocketChat com.nima.socketchatA simple app to chat with anyone you want on the same network.
First release: Apr 24, 2025
- Socks5 Proxy com.socks5
First release: Jul 31, 2026
SocksTun hev.sockstunA simple and lightweight VPN over socks5 proxy (tun2socks)
First release: Jul 31, 2025
- SoftPlus Options com.github.dmitrykouznetsov.softplusoptions
First release: Nov 22, 2025
Solar com.codelv.solarFirst release: Dec 31, 2025
Solid Share com.erfangholami.solidshareFiles, contacts and passes on your own Solid pod, shared on your terms
First release: Sep 15, 2026
Solipsism Browser com.krystelligence.solipsismRail-first browser with privacy tools and one-handed controls
First release: Jul 30, 2026
- Solitaire com.vayunmathur.games.solitaire
First release: Oct 8, 2026
- SolitaireCG net.sourceforge.solitaire_cg
First release: Jul 31, 2026
Solo Forge com.kbul.spicycrabLocal-first intermittent fasting, calorie, weight & workout tracker
First release: Aug 9, 2026
- Solon com.odweta.solon
First release: Oct 4, 2025
- solXpect org.woheller69.solxpect
First release: Dec 27, 2025
songbook com.kiber_bomzh.songbookFirst release: Aug 12, 2026
- Songhay for AnySoftKeyboard com.anysoftkeyboard.languagepack.songhay
First release: Jul 31, 2026
SongSync pl.lambada.songsyncAndroid app to download lyrics for songs in your music library.
First release: May 14, 2025
SongTube com.artxdev.songtubeFirst release: Mar 26, 2024
Sonic 3 A.I.R. org.eukaryot.sonic3airFirst release: Feb 1, 2024
- Soothing Noise Player ie.delilahsthings.soothingloop
Play soothing sound effects to help you relax and drown out background noise.
First release: Jun 8, 2025
- SOS Alerter org.sosalerter.app
First release: Jul 31, 2026
SOS Flashlight org.wbftw.weil.sos_flashlightTurn your phone into a Morse code device, to transmit emergency messages.
First release: Sep 4, 2025
SOS Ring com.lorenzomarci.sosringMake VIP calls and messages audible even in Silent/DND
First release: Aug 31, 2026
- Sossoldi com.ripster.sossoldi
First release: Dec 4, 2025
- SoulCalc net.tigr.soulcalc
First release: Jul 31, 2026
Soul Searching com.github.enteraname74.soulsearchingA complete and powerful music player for Android.
First release: Feb 9, 2026
SoundAura com.cliffracertech.soundauraFirst release: Oct 31, 2025
Sound Center app.soundcenter.playerLocal music, podcast, stream and cloud player, built to enhance your quality of
First release: Aug 1, 2026
SoundCrowd com.tiefensuche.soundcrowdMusic player with support for SoundCloud, YouTube, Spotify, Beatport, and Tidal
First release: Feb 7, 2026
SoundPod com.github.soundpodA minimalist music streaming app
First release: Aug 26, 2026
- Sound Quick Settings fr.smarquis.soundquicksettings
First release: Nov 1, 2024
- Sound Recorder Plus org.codeberg.genericpers0n.soundrecorderplus
First release: Oct 8, 2024
SoundRemote io.github.soundremoteFirst release: May 8, 2025
- Sound Toggle com.grmasa.soundtoggle
First release: Jan 27, 2026
- SoundTree Recorder app.soundtree
First release: Aug 11, 2026
- SourCherry lt.ffda.sourcherry
First release: Aug 27, 2025
Souvenirs fr.nuage.souvenirsMake photo albums and share them on Nextcloud. Support for image, sound, video,
First release: Jan 23, 2026
SpaceBeam com.calmyjane.spacebeamKaleidoscope Camera Fun with Shaders for live visual performances!
First release: Oct 10, 2026
- Space Vertex Multiplayer fr.arnaudguyon.spacevertex
First release: Nov 7, 2025
SpamBlocker spam.blockerSpam Call/SMS blocker
First release: Sep 21, 2025
SpamBlocker Extended dev.kerballone.spamblockerSpam Call/SMS/Notification blocker
First release: Aug 3, 2026
Spam Call Blocker com.addev.listaspamFirst release: Jul 31, 2025
- Spanish for AnySoftKeyboard com.anysoftkeyboard.languagepack.spain
First release: Jul 31, 2026
Spass org.asafonov.spassSmall but effective password manager for android.
First release: Oct 16, 2026
SPAYD dekodér cz.jancejka.spayddecoderOffline decoder for Czech SPAYD payment QR codes.
First release: Oct 8, 2026
SPAZ Radio llm.slop.spazradioPlays the SPAZ.Radio audio stream with audio-reactive visuals.
First release: Jan 6, 2026
- SpeakThat! com.micoyc.speakthat
First release: Sep 9, 2025
- Specie org.billthefarmer.specie
First release: Jul 31, 2026
- Specifically Clementines net.shaytech.groceries
First release: Jul 20, 2025
Spectre dev.thomasbuilds.spectreFirst release: Jul 30, 2026
Speedometer ch.rmy.android.statusbar_tachoFirst release: Aug 31, 2025
SpeedyNote org.speedynote.appFirst release: Aug 21, 2026
- Spell4Wiki com.manimarank.spell4wiki
First release: Sep 20, 2025
Spickerrr de.piratentools.spickerrrFirst release: Feb 3, 2025
Spix com.spix.appPrivacy-first offline fitness tracker with AI rep counter and gamification
First release: Oct 8, 2026
Spix com.spix.app.fossFirst release: Oct 8, 2026
splitcat lol.janjic.splitcatFirst release: Dec 10, 2024
SplitSmart com.splitsmartOffline expense splitting with fair shares and fewest-transfer settlements
First release: Oct 26, 2026
- SpMp com.toasterofbread.spmp
First release: Oct 27, 2024
SponsorCut com.sponsorcutCut SponsorBlock segments from local YouTube videos
First release: Oct 8, 2026
- Spool Maker de.spoolmaker.android
Read and create NFC spool tags for UltiMaker 3D printers
First release: Oct 3, 2026
SportWetter eu.sportwetter.appWhen does the weather suit outdoor sport? Heat, cold, wind, rain, air.
First release: Oct 11, 2026
Spotube org.spotube.spotubeFirst release: Oct 30, 2026
Spotube oss.krtirtho.spotubeFirst release: Sep 11, 2025
SPRAWL//RUN io.github.jbinder.sprawlrunA running tracker wrapped in a cyberpunk story that chases you. Fully offline.
First release: Sep 20, 2026
Squawker org.ca.squawkerAn open-source privacy oriented Twitter/X client
First release: Dec 2, 2025
Squealer futuristicgoo.squealerFirst release: Feb 1, 2026
- Squeeze Client de.maniac103.squeezeclient
First release: Jan 20, 2026
Squeezelite org.lyrion.squeezelite'Headless' audio player for Lyrion Music Server (LMS) - Squeezelite
First release: Aug 20, 2025
- Squeezer uk.org.ngo.squeezer
First release: Dec 11, 2025
- Squircle CE com.blacksquircle.ui
First release: May 14, 2025
- SrednaBG com.demosten.srednabg
First release: Aug 31, 2026
S.S.E. com.paranoiaworks.unicus.android.sseFile Encryption, Text Encryption (Messages, Notes, …), Secure Password Manager
First release: May 29, 2025
SSHBorg com.sshborgSSH & SFTP client for cyborgs and Android. No ads, no tracking, no cloud.
First release: Jul 31, 2026
Sshd4a com.hardbacknutter.sshdFirst release: Jan 8, 2026
- SshDaemon com.daemon.ssh
First release: Feb 5, 2026
SshKeyMan com.catpuppyapp.sshkeymanGenerate/Manage your ssh keys on Android devices
First release: Aug 9, 2025
SSH Remote com.stefansundin.sshremoteFirst release: Oct 8, 2026
- ssrDroid com.ssrlive.ssrdroid
First release: Jan 11, 2025
- SSTV Encoder om.sstvencoder
First release: May 24, 2025
Stack Tower 3D stack.tower3dFirst release: Oct 8, 2026
- Stack Wallet com.cypherstack.stackwallet
First release: Feb 11, 2026
- Staging KeyPass com.yogeshpaliyal.keypass.staging
First release: Dec 2, 2025
- Standard Notes com.standardnotes
An end-to-end encrypted note-taking app for digitalists and professionals
First release: Feb 7, 2026
- Stanza io.github.melastore.stanza
Frosted glass Pomodoro timer with zero-battery chronometer countdown.
First release: Oct 9, 2026
- STARGW FX net.stargw.fx
First release: Jul 31, 2026
Stario com.stario.launcherFirst release: Aug 5, 2025
- Stario com.stario.launcher.debug
First release: Aug 2, 2026
Starling app.starlingmapEnd to end encrypted location sharing. No accounts, no tracking.
First release: Sep 23, 2026
Stashly nodomain.aditya1875more.stashlyStashly – A simple, secure way to manage your personal files and notes.
First release: Jan 30, 2026
- StashPay com.onionmill.stashpay
First release: Sep 17, 2025
- stasis stasis.client.android
First release: Jan 17, 2026
- Stateful Speedometer com.github.timboode.statefulspeedometer
First release: Nov 1, 2025
Status app.status.mobilePrivacy super app with messenger, crypto wallet, browser, communities & more
First release: Aug 16, 2026
Status Legacy im.status.ethereumConnect Private Finance & Web3
First release: Aug 11, 2025
- Stay-Awake on ADB com.duck.stayawakeadb
First release: Feb 6, 2024
- Stay Put org.y20k.stayput
First release: Oct 30, 2025
- Stealth com.cosmos.unreddit
First release: Jun 1, 2025
Steam Server Browser com.steamserverbrowser.appFirst release: Aug 30, 2026
- Stendhal org.stendhalgame.client
First release: Dec 31, 2025
Stepsy com.nvllz.stepsyYour lightweight step counting buddy
First release: Jul 17, 2025
Sterna Mail app.sternaPrivate email client for JMAP and IMAP/SMTP. No Google services, no tracking.
First release: Jul 31, 2026
- Stims acidburn.stims
First release: Aug 1, 2026
- Stingle Photos org.stingle.photos
First release: Oct 17, 2023
Stitch soko.ekibun.stitchStitch screenshots
First release: Feb 11, 2024
Stochastic Reminder cc.polysfaer.stochapopFixed and random reminder scheduler.
First release: Jul 29, 2026
- Stoic Reading app.reading.stoic.stoicreading
First release: Jan 19, 2026
Stopptanz com.stopptanz.appFreeze Dance & Musical Chairs music timer, fully offline
First release: Aug 26, 2026
- Stopwatch com.github.muellerma.stopwatch
First release: Jul 18, 2025
Storii com.likhithpraveenk.storiiAudiobookshelf client with downloads, accurate playback sync, and Android Auto
First release: Aug 1, 2026
- StoryGame eu.webdragon.storygame
First release: Jan 24, 2025
Stratum com.stratumauth.appFirst release: Aug 17, 2025
Streak com.streak.appA minimal, private, ad-free habit tracker. One tap to log, watch streaks grow.
First release: Aug 4, 2026
Streak org.rayg.streaktrackerLightweight & Minimal daily streak tracker, built in C.
First release: Dec 16, 2025
- StreamPlayer com.streamplayer.app
First release: Jul 31, 2026
- StreamPlayer nl.sonck.streamplayer
First release: Jul 31, 2026
StreetComplete de.westnordost.streetcompleteFirst release: Aug 18, 2025
- StreetMeasure de.westnordost.streetmeasure
First release: Feb 25, 2025
Stride org.stridetasks.strideTask management tool that synchronizes with git.
First release: Sep 20, 2024
- @string/app_name mobi.maptrek
First release: Mar 28, 2024
- Stroke Input Method io.github.yawnoc.strokeinput
First release: Dec 27, 2025
strongSwan VPN Client org.strongswan.androidAn easy to use IKEv2/IPsec-based VPN client.
First release: Nov 3, 2025
- Stud Finder org.bitanon.studfinder
First release: Sep 23, 2026
StudiPassau studip_uni_passau.femtopedia.de.unipassaustudipAccess to the Online Portal for Students at the University of Passau
First release: Oct 8, 2026
StudyDesk com.StudyDesk.appKnow what to study next — a decision-free study tracker
First release: Jul 30, 2026
- study tracker com.edward.studytracker
First release: Jul 31, 2026
Stutter org.tomasino.stutterSpeed-reading app that shows one word at a time with adjustable timing
First release: Oct 8, 2026
StyncyNotes org.grating.styncynotesFirst release: Aug 16, 2025
sub rosa acab.naiveha.subrosaFirst release: Aug 2, 2026
- sub rosa acab.naiveha.subrosa.by.naiveha
First release: Aug 22, 2026
- SubSonicSter rocks.langhaarschneider.subsonicster
First release: Jul 31, 2026
Subster app.substerMusic timeline party game that plays songs from your own Subsonic library
First release: Jul 31, 2026
Substitution plan io.vertretungsplan.client.androidFirst release: Jan 28, 2025
- Substratum Tweaks com.luisbocanegra.substweaks
First release: Feb 25, 2025
- Subtitle Blocker com.subtitlescreen
First release: Jul 31, 2026
subtracks com.subtracksA clean, open source Subsonic music player
First release: Oct 10, 2026
- Subway Tooter jp.juggler.subwaytooter
First release: Mar 9, 2025
Subway Tooter jp.juggler.subwaytooter.noFcmFirst release: Oct 8, 2026
Sudaku com.gitea.theoden8.sudakuFind patterns to solve sudoku - your sudoku workhorse handles the grunt work
First release: May 6, 2023
sudoku org.benoitharrault.sudokuFirst release: Oct 8, 2026
Sudoku com.likhithpraveenk.sudokuA clean Sudoku app with logic-based difficulty and helpful assists
First release: Jul 31, 2026
- Sudoku org.secuso.privacyfriendlysudoku
First release: Feb 9, 2026
Sudoku You com.galaxyrio.sudokusolverOffline Sudoku with logical hints, advanced notes and flexible import/export
First release: Aug 27, 2026
SudoQ de.sudoqPlay many sudoku types, with many assistances, all offline.
First release: Feb 1, 2026
- Sugarizer org.olpc_france.sugarizer
First release: Mar 28, 2024
- Sumatora org.happypeng.sumatora.android.sumatoradictionary
First release: Oct 8, 2026
- Sumire Japanese Keyboard com.kazumaproject.markdownhelperkeyboard
First release: Aug 4, 2026
Sumire Japanese Keyboard Lite F-Droid com.kazumaproject.markdownhelperkeyboard.lite.fdroidPrivate offline Japanese keyboard with user dictionary and snippets
First release: Jul 31, 2026
Summit com.idunnololz.summitFirst release: Aug 17, 2026
Summit com.idunnololz.summit.fdroidA fast and easy to use app for Lemmy and PieFed
First release: Oct 25, 2026
Sunmachine pl.blach.sunmachineFirst release: Feb 27, 2024
Sun Piano code.alimiracle.sunpianoPiano and synthesizer with 8 instruments, recording, metronome and MIDI input
First release: Oct 11, 2026
SunProxy io.github.ulysseszh.sunproxyFirst release: Aug 17, 2025
Sunrise Signal com.avizitrx.sunrise.signalMorning wood tracker app to gain health insights
First release: May 1, 2025
- Suntimes com.forrestguice.suntimeswidget
First release: Jan 1, 2026
- Suntimes Calendars com.forrestguice.suntimescalendars
First release: Feb 15, 2024
Sunup org.unifiedpush.distributor.sunupUnifiedPush distributor using Mozilla's push server
First release: Feb 11, 2026
- SuperFreezZ superfreeze.tool.android
First release: Jul 31, 2026
SuperImage com.zhenxiang.superimageSharpen your low-resolution pictures with the power of AI upscaling
First release: Apr 13, 2023
Supernova com.supernova.launcherA deeply customizable, offline home screen with gestures, folders and a feed.
First release: Oct 23, 2026
Super Productivity com.superproductivity.superproductivityFree to do list & time tracker
First release: Feb 9, 2026
- Super Retro Mega Wars com.serwylo.retrowars
First release: Aug 21, 2024
- SuperShopaholic com.supershopaholic
First release: Jul 31, 2026
SuperSMP Companion com.freetime.ssmpcVote, shop & explore SuperSMP anywhere! Companion app for server features
First release: Aug 23, 2026
Supertonic TTS com.brahmadeo.supertonic.ttsLocal AI Text-to-Speech using Supertonic ONNX
First release: Jul 29, 2026
SuperTuxKart org.supertuxkart.stkFirst release: Oct 20, 2025
SuperX com.myAllVideoBrowserVideo downloader with browser for downloading videos from everywhere
First release: Feb 4, 2026
- SupIR xyz.regulad.supir
First release: Nov 23, 2024
Sure Finances am.sure.mobileFirst release: Mar 31, 2026
Surge Engine org.opensurge2d.surgeengineFirst release: Oct 8, 2026
- Surge Engine org.opensurge2d.surgeengine.ale
First release: Jan 28, 2026
- Survival Manual org.ligi.survivalmanual
First release: Oct 26, 2024
Suspension Setup ch.pec0ra.suspension_setupFirst release: Oct 7, 2026
svampkompass bengtsson.net.svampkompassA compass that show you the way to your stored mushroom spots
First release: Sep 29, 2026
- Svarka Odds Calculator eu.veldsoft.svarka.odds.calculator
First release: Jul 31, 2026
- Swap com.swap.app
First release: Jul 31, 2026
- Swatch .beat clock eu.mirkodi.swatchbeatclock
First release: Jan 28, 2024
- SwatchIt net.damschen.swatchit
First release: Jan 24, 2026
- SWeb landau.sweb
First release: Feb 21, 2025
- Swedish for AnySoftKeyboard com.anysoftkeyboard.languagepack.swedish
First release: Jul 31, 2026
SwiftSlate com.musheer360.swiftslateSystem-wide AI text assistant — type a trigger, get instant text transformation
First release: Jul 31, 2026
Swiss Bitcoin Pay ch.swissbitcoinpay.checkout1 minute to accept Bitcoin in your business.
First release: Sep 22, 2025
Symphony io.github.zyrouge.symphonyFirst release: Dec 14, 2024
- Syncara syncara.app
First release: Dec 31, 2025
- SyncRecordApp app.mcevoy.syncrecordapp
First release: Aug 23, 2026
- Sync Settings de.spiritcroc.syncsettings
First release: Oct 15, 2019
- Syncthing-Fork com.github.catfriend1.syncthingandroid
First release: Dec 8, 2025
Syncthing-Fork com.github.catfriend1.syncthingforkFirst release: Sep 24, 2025
Syncthing-Lite com.github.catfriend1.syncthingliteFirst release: Aug 4, 2025
- SyncTool theakki.synctool
First release: Jun 2, 2024
- SyncUp com.siddarthkay.syncup
First release: Sep 25, 2026
Synkplay com.reddnek.syncplayFirst release: Nov 18, 2025
- Synkplay com.yuroyami.syncplay
First release: Apr 11, 2026
- Synkplay com.yuroyami.synkplay
First release: Mar 18, 2026
SysAdmin dev.prathameshkhade.sysadminLinux server management in your pocket. Manage servers on the go via SSH!
First release: Jul 5, 2025
Sysctl GUI com.androidvip.sysctlguiFirst release: Aug 21, 2025
- SysLog com.tortel.syslog
First release: Jan 24, 2024
SystemUI Tuner com.zacharee1.systemuitunerFirst release: Feb 17, 2024
T2DECODE org.t2decode.appOffline interactive learning platform for IT, Cybersecurity, and Networking.
First release: Aug 17, 2026
Tabata Xtreme com.fiveseven.tabataxtremeFirst release: Oct 8, 2026
TabGreater com.neatcode.tabgreaterCrypto watchlist with live prices, charts and home-screen widgets
First release: Sep 26, 2026
TABI dev.lorsupra.tabiLearn Japanese from zero in about five minutes a day.
First release: Oct 3, 2026
- TableChips io.github.tablechips
Chips for a card table. One phone hosts; guests join from a browser, offline.
First release: Oct 15, 2026
Table Habit io.github.friesi23.mhabitFirst release: Sep 22, 2025
- Tabletop Tools com.github.muellerma.tabletoptools
First release: Mar 19, 2024
TachiyomiSY eu.kanade.tachiyomi.syFirst release: Oct 8, 2026
- Tack xyz.zedler.patrick.tack
First release: Feb 13, 2026
TacticMaster com.tacticmasterFirst release: Jul 18, 2025
- Tactile Clock de.eric_scheibler.tactileclock
First release: Jan 18, 2026
TaffyQSL moe.zzy040330.taffyqslFirst release: Oct 8, 2026
- tagdrop com.github.mofosyne.tagdrop
First release: Aug 1, 2026
TagMacro dev.tagmacroTap an NFC tag to run actions, or write tags for Wi-Fi, links and contacts
First release: Oct 12, 2026
TagSpaces org.tagspaces.mobileappFirst release: Feb 12, 2026
Taiga Mobile com.grappim.taigamobileFirst release: Jul 29, 2026
- Taiga Mobile com.grappim.taigamobile.fdroid
First release: Jul 31, 2026
Tailscale com.tailscale.ipnFirst release: Aug 7, 2025
Taison com.gent8.taisonFirst release: Dec 7, 2025
Taler POS net.taler.merchantposProcess orders and take in Taler payments
First release: Sep 2, 2026
Taler Wallet net.taler.wallet.fdroidFirst release: Aug 4, 2026
Talk com.nextcloud.talk2Have private video calls and chat using your own server.
First release: Dec 2, 2024
talkback com.android.talkbackFirst release: Nov 29, 2024
Tally app.tally.expensesOne tap per expense. Every account, every currency. Private, offline, no ads.
First release: Oct 16, 2026
Tallybook io.github.herrerad85.tallybookPrivate, offline-first expense and budget tracker, no account required
First release: Aug 1, 2026
- Tamazight for AnySoftKeyboard com.anysoftkeyboard.languagepack.tamazight
First release: Jul 31, 2026
Tane org.comunes.taneFirst release: Jul 28, 2026
- Tangram com.xmission.trevin.android.tangram
First release: Sep 3, 2026
- Tankblick de.mymiggi.tankblick
First release: Aug 4, 2026
Tapbar com.earendel.tapbarLaunch apps or quick actions from the status bar or anywhere on your screen
First release: Oct 8, 2026
TapDucky org.kaijinlab.tap_duckyRun DuckyScript over USB HID. Import, schedule, and manage payloads (root)
First release: Oct 8, 2026
- Tape Measure org.secuso.privacyfriendlytapemeasure
First release: Jul 30, 2025
- Tapjacking Bypass io.github.ephemera42.tapjackingbypass
First release: Jul 31, 2026
TapLock com.ah.taplockLock your screen instantly with a double tap.
First release: Jul 28, 2026
Tarifa luz com.github.webierta.tarifa_luzRegulated electricity rate in Spain (PVPC)
First release: Apr 25, 2025
Tarjeta Bus dev.hloth.zaragoza_tarjeta_busFirst release: Sep 2, 2026
- Tarnhelm cn.ac.lz233.tarnhelm
First release: Jul 6, 2025
- Taskbar com.farmerbb.taskbar
First release: Oct 2, 2024
- TaskerHA com.github.db1996.taskerha
First release: Dec 19, 2025
- TaskManager com.rk.taskmanager
First release: Sep 2, 2025
TaskMate com.amirsteinbeck.taskmateA simple, clean, distraction-free task manager for daily focus.
First release: Feb 5, 2026
Tasky com.thatsmanmeet.taskyappTasky is a highly intuitive and easy-to-use todo list app
First release: Jul 28, 2024
- Tchap Classique fr.gouv.tchap.a
First release: Sep 3, 2026
- T CrB Detector com.oliverszabo.tcrbdetector
First release: Jul 21, 2025
- TDX com.dev.tunedetectivex
First release: Aug 12, 2025
- Tehran Metro com.ma.tehro
First release: Jul 26, 2025
Telegram org.telegram.messenger.webFirst release: Jan 19, 2026
Telegram X org.thunderdog.challegramAn unofficial FOSS-friendly fork of Telegram X
First release: Sep 7, 2026
- Telewatch com.gohj99.telewatch
First release: May 24, 2025
- Tella org.hzontal.tellaFOSS
First release: Feb 19, 2025
- Template de.binarynoise.Template
First release: Oct 15, 2025
- Tempo com.cappielloantonio.tempo
First release: Dec 31, 2024
Tempus com.eddyizm.degoogled.tempusAn open-source and privacy focused music client for Subsonic
First release: Oct 9, 2026
- Tempus com.eddyizm.tempus
First release: Feb 9, 2026
- Tempus Romanum com.dev.xavier.tempusromanum
First release: Nov 25, 2025
Tensy se.voxelmanip.tensyFirst release: Dec 7, 2025
Tents com.sidhant.tentsA logic puzzle game where goal is to place tents in the grid
First release: Sep 17, 2026
Terminal Emulator com.termoneplusTurn your device into a computer terminal
First release: Sep 5, 2025
Terminator com.terminator.appMulti-session terminal emulator with Material UI theming and root support
First release: Aug 12, 2026
- TermuC cn.rbc.termuc
First release: Nov 7, 2025
Termux com.termuxTerminal emulator app with a large set of command line utilities
First release: May 22, 2025
- Termux:API com.termux.api
First release: Sep 1, 2025
- Termux:Boot com.termux.boot
First release: Jun 22, 2024
- Termux:Float com.termux.window
First release: Sep 2, 2025
- Termux:GUI com.termux.gui
First release: Apr 29, 2023
- Termux Hub com.maazm7d.termuxhub
First release: Jan 29, 2026
- Termux:Styling com.termux.styling
First release: Jun 22, 2024
- Termux:Tasker com.termux.tasker
First release: Sep 2, 2025
- Termux Terminal Widget com.gardockt.termuxterminalwidget
First release: Oct 29, 2025
Termux:Widget com.termux.widgetFirst release: Sep 2, 2025
Tern io.github.munzzyy.ternFollow app releases where they are published and check them before they install
First release: Oct 3, 2026
TerraTactician Expandoria page.codeberg.terratactician_expandoriaFirst release: May 2, 2025
- Tessel net.vantulder.tessel
First release: Dec 27, 2025
- Tessella art.tessell.editor
First release: Aug 14, 2026
- Test DPC com.afwsamples.testdpc
First release: Sep 9, 2024
Tetherbug ie.xav.tetherbugYour Mac turns on your phone's hotspot when its Wi-Fi disconnects. No taps.
First release: Oct 12, 2026
TetherFuseNet com.pyamsoft.tetherfiNo Root Wi-Fi Tethering
First release: Aug 25, 2025
- TeXeTeScribe barilyuk.texetescribe
First release: Nov 9, 2025
- TeXslate de.bgg_home.texslate
First release: Sep 29, 2026
- Text Launcher ademar.textlauncher
First release: Jan 19, 2026
textlog dev.serge.textlogA text-first mobile client for textlog.cc — no algorithm, no metrics, no ads
First release: Sep 9, 2026
- TextTL io.github.karino2.texttl
First release: Nov 6, 2025
Text Tools com.corphish.quicktoolsUseful text related functions that can be done on the selected text
First release: Jan 4, 2026
- Teyin com.rama.teyin
First release: Aug 16, 2026
TgMonet Theme com.c3r5b8.telegram_monetFirst release: Apr 13, 2025
TG WS Proxy io.github.valnesfjord.tgwsproxyrsTelegram MTProto WebSocket Bridge Proxy
First release: Oct 2, 2026
- Thai for AnySoftKeyboard com.anysoftkeyboard.languagepack.thai
First release: Jul 31, 2026
Thank You org.fossify.thankyouFirst release: Jan 30, 2026
The Battle for Wesnoth org.wesnoth.WesnothA turn-based strategy game with a high fantasy theme
First release: Jan 23, 2026
- The Kana Quiz com.noprestige.kanaquiz
First release: Mar 7, 2024
The Last Carrot io.github.acidefluorhydrique.carrotA cheerful tower defence game with no ads, no trackers and no permissions
First release: Sep 7, 2026
The Life org.hlwd.bible_multi_the_lifeBible multi languages, free, offline, no advertising.
First release: Jul 24, 2025
- The Light org.hlwd.bible
First release: Dec 23, 2025
The One App io.theoneappApplication for managing a player's characters in the RPG The One Ring.
First release: Feb 11, 2026
Therapiefinder org.therapiefinderFirst release: Nov 13, 2025
- Thermocouples com.southerntemp.thermocouples
First release: Sep 18, 2025
The Universe Decides com.hugo.theuniversedecidesCan't decide? Let the universe choose.
First release: Aug 3, 2026
TheXTech ru.wohlsoft.thextechFirst release: Dec 26, 2025
- TheXTech ru.wohlsoft.thextech.fdroid
2D-platformer game engine
First release: Oct 12, 2026
- The Verge wallpapers for Muzei de.salomax.muzei.thevergewallpapers
First release: Jan 20, 2024
- Thirukural Daily com.abezb.thirukuraldaily
First release: Jul 31, 2026
Thor com.valhalla.thorFreeze apps, debloat and uninstall system apps with Root, Shizuku or Dhizuku.
First release: Dec 29, 2025
Thor threads.thorFirst release: Oct 1, 2025
- ThreadScoopOnionChat com.bwt.threadscooponionchatcom
First release: Feb 28, 2025
Threema Libre ch.threema.app.libreFirst release: Dec 11, 2025
- Thud com.aerotoad.thud
First release: May 2, 2024
Thumb-Key com.dessalines.thumbkeyA privacy-conscious keyboard made for your thumbs.
First release: Feb 7, 2026
- Thunder com.hjiangsu.thunder
First release: Jan 7, 2026
Thunderbird net.thunderbird.androidFirst release: Sep 3, 2025
Thunderbird Beta net.thunderbird.android.betaThunderbird is a 100% open source, privacy focused email app.
First release: Feb 17, 2026
TIC-80 com.nesbox.ticFirst release: Oct 4, 2026
Tickdroid com.martinhammer.tickdroidDaily habit and event tracker for Nextcloud
First release: Sep 9, 2026
- Tickmate de.smasi.tickmate
First release: Jan 20, 2025
TicTacToe com.itsfrz.tictactoeFirst release: Aug 5, 2026
Tic Tac Toe com.princeappstudio.tic_tac_toeFirst release: May 25, 2024
- Tiddloid top.donmor.tiddloid
First release: Feb 17, 2024
- Tiddloid Lite top.donmor.tiddloidlite
First release: Feb 12, 2024
Tideo Auto Brightness com.tideo.autobrightnessA glass-box replacement for Android's adaptive brightness
First release: Aug 2, 2026
Tidy com.Ace777.tidyFirst release: Aug 10, 2026
tiefprompt io.github.tiefseetauchner.tiefpromptFirst release: Apr 16, 2025
TigerDuck org.ntust.app.tigerduckFirst release: Oct 9, 2026
- TigerDuck org.ntust.app.tigerduck.fdroid
NTUST campus assistant for courses, assignments, and more
First release: Aug 23, 2026
Tilde Friends com.unprompted.tildefriends.fdroidA Secure Scuttlebutt decentralized social network client
First release: Aug 1, 2026
Tile Match infrared.tilematchFirst release: Oct 8, 2026
- Timed Shutdown com.maforn.timedshutdown
First release: Jan 19, 2026
- Timed Silence de.felixnuesse.timedsilence
First release: Oct 19, 2024
- TimeLapseCam org.woheller69.TimeLapseCam
First release: Sep 29, 2025
TimeLimit io.timelimit.android.aosp.directFirst release: Aug 1, 2025
- TimeLimit io.timelimit.android.open
First release: Aug 6, 2024
TimePlanner ru.aleshin.timeplannerTimePlanner - plan your day with ease, speed, and pleasure!
First release: Nov 29, 2024
TimeR Machine io.github.deweyreed.timer.otherA highly customizable interval timer
First release: Sep 9, 2025
Timer +X net.xisberto.timerpxCreate alarms for predefined time increments
First release: Sep 16, 2024
timeto.me me.timeto.appGoals, checklists, tasks, repetitive tasks, calendar and 24/7 time tracking.
First release: Feb 10, 2026
time-tracking de.killi199.timetrackingFirst release: Aug 30, 2026
Timety io.github.benji377.timetyOffline-first productivity, focus, and habit tracking.
First release: Aug 11, 2026
Timidity AE com.xperia64.timidityaeFirst release: Oct 1, 2024
Tinc Mesh VPN org.pacien.tincappTinc mesh VPN client and user interface
First release: Oct 7, 2024
Tine page.tine.appFast local-first Logseq-compatible outliner
First release: Aug 21, 2026
- TinyBit launcher rocks.tbog.tblauncher
First release: May 8, 2024
- Tiny Keyboard rkr.tinykeyboard.inputmethod
First release: Jun 13, 2025
- Tiny Weather Forecast Germany de.kaffeemitkoffein.tinyweatherforecastgermany
First release: Aug 7, 2025
- Tip Calculator quest.faraday.tip_calculator
First release: Jul 31, 2026
Tirailleur com.bupkis.tirailleurFirst release: Oct 8, 2026
Titanius Launcher app.titanius.launcherFirst release: Jan 1, 2024
Title Track de.singular.recorderA recorder for music memos.
First release: Sep 9, 2026
- Tjoeke nl.tjoeke.android
First release: Sep 5, 2026
TKWeek com.thomaskuenneth.tkweekA date and calendaring tool for Android
First release: Jan 5, 2026
- TLSFragment org.maoist2009.tlsfragment
First release: Dec 7, 2025
tmtLauncher com.tinnamchoi.tmtlauncherFirst release: Jan 23, 2026
Toadua town.robin.toaduaThe collaborative Toaq dictionary
First release: Mar 26, 2025
Today Stocks com.github.premnirmal.tickerwidgetStock market ticker widget
First release: Sep 16, 2025
Todo com.k.todoSecure offline To-Do & Notes with biometric lock.
First release: Dec 21, 2025
- To Do com.xmission.trevin.android.todo
First release: Jun 2, 2025
- Todo Agenda org.andstatus.todoagenda
Home screen widgets displaying events from selected calendars and task lists
First release: Mar 20, 2025
- To-Do List org.secuso.privacyfriendlytodolist
First release: Jan 17, 2026
- To Don't rocks.poopjournal.todont
First release: Dec 19, 2025
- Todopad com.example.flutter_riverpod_todo_app
First release: Feb 29, 2024
Todosian com.isotjs.todosianManage Obsidian todo lists. Edit Markdown files directly; no account or sync
First release: Aug 22, 2026
- TodoTree nl.tsmeets.todotree
First release: Mar 20, 2024
ToFShare com.zoffcc.applications.tofshareToFShare FileShare via Tox
First release: Feb 6, 2026
- Toggle Lineage Profiles com.saiho.togglelineageprofiles
First release: Feb 4, 2025
- Toki Pona Dictionary com.tre.tokiponadict
First release: Jul 23, 2025
Tokn me.diamondforge.toknOpen-source 2FA authenticator. Encrypted on-device. No accounts.
First release: Aug 1, 2026
ToLoShare com.zoffcc.applications.toloshareToLoShare Location Share via Tox
First release: Feb 6, 2026
Tomato org.nsh07.pomodoroMinimalist Pomodoro timer
First release: Feb 7, 2026
tomodoro ir.shahriaarrr.tomodoroA modern Pomodoro timer and task manager.
First release: Aug 6, 2025
- TonUINO NFC Tools de.mw136.tonuino
First release: Oct 29, 2024
- toodoo com.wattwurm.toodoo
First release: Jul 31, 2026
Tool Telegram dev.trindadedev.tooltelegramFirst release: Feb 21, 2025
- TopoSuite ch.hgdev.toposuite
First release: May 4, 2025
- Torchlight com.secuso.torchlight2
First release: Jul 14, 2025
ToReplace com.tymwitko.toreplaceFirst release: Oct 13, 2026
Torrent Player webtor.appStream and download torrents directly on Android with external media players.
First release: Oct 26, 2026
Torrents-csv com.torrents_csv_androidA search engine for Torrents-csv.
First release: Oct 30, 2024
Torrents Digger org.forthecommunity.torrentsdiggerDig Torrents from Internet.
First release: Feb 7, 2026
- Torrent Search com.prajwalch.torrentsearch
Search torrents across multiple providers simultaneously
First release: Jan 29, 2026
TorrServe MatriX ru.yourok.torrserveDownload torrent files
First release: Dec 24, 2025
TorServices org.torproject.torservicesFirst release: Feb 28, 2024
Tor VPN org.torproject.vpnFirst release: Aug 21, 2026
ToS;DR xyz.ptgms.tosdrFirst release: Mar 30, 2025
Total Recall com.qq7te.totalrecallPrivacy-focused memory helper app. Photo, text, location. All locally stored.
First release: Jan 1, 2026
Touch Torch com.softcodingforyou.touchtorchFirst release: Apr 21, 2025
- TourCount com.wmstein.tourcount
First release: Feb 1, 2026
- Tournant eu.zimbelstern.tournant
First release: Jan 27, 2023
- tower truewatcher.tower
First release: Jul 31, 2026
Tower Collector info.zamojski.soft.towercollectorJoin the community and collect cell towers locations from your area!
First release: Dec 19, 2025
- Traccar Manager org.traccar.manager
First release: Apr 17, 2025
traced it app.traced_itQuick notes with time & amounts
First release: Feb 10, 2026
Trackbook org.y20k.trackbookFirst release: Nov 13, 2025
TrackerControl net.kollnig.missioncontrolTrackerControl allows to monitor and control hidden data collection in apps.
First release: Dec 15, 2024
TrackerControl net.kollnig.missioncontrol.fdroidTrackerControl allows to monitor and control hidden data collection in apps.
First release: Jul 31, 2026
Track Exploder com.safrone.trackexploderExtract, remix, and practise with barbershop learning tracks
First release: Oct 8, 2026
Track & Graph com.samco.trackandgraphDashboards for life!
First release: Jan 24, 2026
- Track Work Time org.zephyrsoft.trackworktime
First release: Aug 24, 2025
- Traditional T9 io.github.sspanak.tt9
First release: Feb 2, 2026
Traffic Light com.leekleak.trafficlightTrack your network and data usage with privacy
First release: Feb 7, 2026
Trailence trailence.orgYour hiking companion and GPS track manager. Open source, no trackers.
First release: Feb 6, 2026
- Trail Sense com.kylecorry.trail_sense
First release: Jan 15, 2026
Trails Hito com.hito.trails.appFirst release: Oct 8, 2026
trale de.quantumphysique.traleprivacy-respecting body weight-diary
First release: Feb 3, 2026
- Tranquil Stopwatch tibarj.tranquilstopwatch
First release: Feb 6, 2026
Transcribro dev.soupslurpr.transcribroFirst release: Aug 7, 2025
- Transdroid org.transdroid.full
First release: Nov 10, 2024
- Transdrone org.transdroid.lite
First release: Jul 31, 2026
- TransektCount com.wmstein.transektcount
First release: Feb 1, 2026
- Transfer com.matanh.transfer
First release: Jan 30, 2026
Transistor org.y20k.transistorTransistor is an app for listening to radio stations over the internet.
First release: May 12, 2022
Transito ht.sr.git.mil.transitoFirst release: Jul 6, 2025
Translate You com.bnyro.translatePrivacy focused translator app built with MD3
First release: Feb 7, 2026
- translationRecorder org.wycliffeassociates.translationrecorder
First release: Aug 16, 2019
- Translator dev.davidv.translator
First release: Oct 15, 2025
- Translucent Shade com.asyjaiz.A12blur
First release: Oct 16, 2024
Transmission BTC com.ap.transmission.btcTransmission BitTorrent Client
First release: Oct 25, 2021
- Transparent Widget com.easwareapps.transparentwidget
First release: Jul 31, 2026
- Transportia one.wafler.transportia
First release: Aug 3, 2026
Transportr de.grobox.liberarioFree Public Transport Assistant without Ads or Tracking
First release: Dec 7, 2024
Transport Widgets com.eden.livewidgetLive bus, metro, trains and more widget.
First release: Sep 12, 2025
Transport You net.youapps.transportPrivacy focused public transport app built with MD3
First release: Dec 18, 2025
- Träwelldroid de.hbch.traewelling
First release: Feb 8, 2026
Trayzero app.cleartrayFirst release: Oct 7, 2026
Treasure Hunt nodomain.neonbranch.treasurehuntFirst release: Sep 22, 2026
- Treehouses Remote io.treehouses.remote
First release: Dec 18, 2025
Tremotesf org.equeim.tremotesfRemote-control Transmission BitTorrent client
First release: Jan 15, 2026
Trending AI whl.trending.aiDaily AI picks from GitHub Trending, Hacker News & Product Hunt.
First release: Aug 4, 2026
Tridenta org.stypox.tridentaTrentino public transport: trips, lines and stops
First release: Apr 5, 2025
TRIfA com.zoffcc.applications.trifaTRIfA Tox Client
First release: Sep 30, 2025
Trigger com.example.triggerFirst release: Feb 8, 2026
- Trilium Notes eu.fliegendewurst.triliumdroid
First release: Jan 20, 2026
Trime com.osfans.trimeChinese IME with Rime Input Method Engine
First release: Jan 1, 2026
- TriPeaks ogz.tripeaks
First release: Sep 19, 2024
TriPeaks NEUE io.github.mimoguz.tripeaksneueA simple Tri Peaks game.
First release: May 11, 2025
- Tri Peaks Solitaire for Android eu.veldsoft.tri.peaks
First release: Jul 31, 2026
Triple Match com.sidhant.triplematchA minimal, open-source 3D tile-matching puzzle game.
First release: Sep 11, 2026
Trivia App com.nima.triviaappA simple app that pulls out trivia out of OpenTriviaDB and challenges you.
First release: May 8, 2025
trudido com.trudido.appPrivacy-friendly, open-source to-do list app. No ads, no tracking.
First release: Dec 12, 2025
TrustDevice Fingerprint com.trustdevice.android.demoFirst release: Dec 4, 2025
- Truvark de.lukaspieper.truvark
First release: Jul 31, 2026
Tryst app.trystPrivate, offline, encrypted tracker for your intimate life.
First release: Sep 3, 2026
Tsacdop com.stonegate.tsacdopEnjoy podcasts with Tsacdop! An open source podcast player built with flutter.
First release: Sep 5, 2026
- Tsacdop-Fork dev.lojcs.tsacdop
Enjoy podcasts with Tsacdop-Fork! A clean, simply beautiful, and friendly app.
First release: Nov 10, 2025
TTL Changer com.mrsep.ttlchangerAn app to change default TTL value
First release: Sep 24, 2024
- TTRSS-Reader org.ttrssreader
First release: Dec 30, 2025
- TTS Util com.danefinlay.ttsutil
First release: Feb 10, 2026
- Tubester org.codeberg.pako.tubester
First release: Aug 10, 2026
- Tubular org.polymorphicshade.tubular
First release: Aug 4, 2025
TU Expense Tracker com.tu.expense.managerPrivate, offline-first expense tracking directly from bank SMS alerts.
First release: Oct 3, 2026
- Tui com.rama.tui
First release: Aug 5, 2026
Tuisku com.omaawr.tuiskuA simple and lightweight encrypted notes app
First release: Jul 31, 2026
- Tumblr Downloader io.github.akarimarisa.tumblrdownloader
First release: Sep 7, 2026
- TuneFriend com.tunefriend.app
First release: Jul 31, 2026
Tuner com.bobek.tunerA simple and precise tuner
First release: Oct 2, 2026
Tuner de.moekadu.tunerApp for tuning musical instruments.
First release: Jul 16, 2025
- Tuner org.billthefarmer.tuner
First release: May 22, 2023
- Tune Tangler pro.kwiatek.tune_tangler
First release: Jul 31, 2026
- Tuning fork io.github.poretsky.tuningfork
First release: Nov 30, 2024
- TunnelForge io.github.evokelektrique.tunnelforge
First release: Jul 31, 2026
- Turkish for AnySoftKeyboard com.anysoftkeyboard.languagepack.ossturkish
First release: Jul 31, 2026
Turns Of War com.github.msx80.turnsofwarFirst release: Oct 8, 2026
Turtle com.amrdeveloper.turtleA Platform with Pythonic language to practice CPU/GPU programming on mobile
First release: Oct 7, 2026
Tusky com.keylesspalace.tuskyA multi account client for the social network Mastodon
First release: Feb 10, 2026
Tuta Calendar de.tutao.calendarFirst release: Jan 9, 2026
Tuta Drive de.tutao.driveFirst release: Jun 9, 2026
- Tutto Counter de.georgelsas.tuttocounter
First release: Feb 5, 2026
- Tuty Fruty Slot for Android eu.veldsoft.tuty.fruty.slot
First release: Sep 16, 2025
- Tux Paint org.tuxpaint
First release: Mar 1, 2024
TV Randshow deandrea.matias.tv_randshowchoose a random TV show episode
First release: Nov 25, 2025
- TV Remote com.porter.tvremote
First release: Aug 1, 2026
TV Viewer app.tvviewer.playerFree open-source IPTV player with community channels and opt-in analytics.
First release: Oct 13, 2026
Twig com.twig.appDual-pane file manager: archives, SFTP, SMB, WebDAV, S3, restic, Jellyfin
First release: Oct 16, 2026
TwiliRecipes net.curiana.recipesFirst release: Feb 9, 2026
Twine dev.sasikanth.rss.readerRead news your way. No algorithms, just your favorite RSS feeds.
First release: Apr 2, 2026
- Twine dev.sasikanth.rss.reader.foss
First release: Jan 21, 2026
Twire com.perflyst.twireTwire is an open source, ad-free Twitch browser and stream player for Android.
First release: Aug 20, 2025
- Txori com.rama.txori
First release: Aug 1, 2026
TypeAssist com.typeassist.appAI-powered accessibility assistant for intelligent text transformations.
First release: Aug 13, 2026
Tyr com.jbselfcompany.tyrFirst release: Dec 30, 2025
Überböse io.github.juliusd.ueberboese.appFirst release: Jul 29, 2026
- Udderance AAC app.udderance
First release: Jul 6, 2025
- Ukrainian for AnySoftKeyboard com.anysoftkeyboard.languagepack.ukrainian
First release: Jul 31, 2026
- Ultrasonic org.moire.ultrasonic
First release: Jul 31, 2026
- Ultrasonic org.moire.ultrasonic.gitlab
First release: Aug 3, 2026
Umihi Music ca.ilianokokoro.umihi.musicA simple Material YouTube Music player
First release: Feb 9, 2026
Umpire Assistant com.adiamas.umpireassistantPitch count and score tracker for baseball, softball, and kickball officials.
First release: Oct 3, 2026
UnApkm io.github.muntashirakon.unapkmDecrypt Apk Mirror's APKM files and save them as APKS
First release: Aug 23, 2025
Unblock Jam com.vayunmathur.games.unblockjamFirst release: Jan 1, 2026
Unchained com.github.livingwithhippos.unchainedFirst release: Nov 28, 2025
- Unchained-dev com.github.livingwithhippos.unchained.debug
First release: Aug 3, 2026
- Unciv com.unciv.app
Open source 4X civilization-building game
First release: Feb 8, 2026
Under Eat com.zoffcc.applications.undereatRestaurant Organiser
First release: Feb 6, 2026
Unexpected Keyboard juloo.keyboard2First release: Jul 8, 2025
Unfurlit io.github.originalrecipe1.unfurlitOpen social-media links in a private native media viewer
First release: Oct 17, 2026
- UnicodePad jp.ddo.hotmist.unicodepad
First release: Sep 16, 2025
UniPatcher org.emunix.unipatcherUtility to apply patches to ROMs
First release: Nov 15, 2024
- Unistroke Keyboard com.whitedavidp.unistroke_keyboard
First release: Nov 1, 2025
UniThen de.bixilon.unithenUnofficial course check in app for UniNow digital booking systems (DBS)
First release: Sep 16, 2026
- Units de.buttercookie.units
First release: Jan 25, 2024
UnitsTool com.unitstoolAn application to convert units
First release: Jun 27, 2025
Universal Installer app.pwhs.universalinstallerAPK/XAPK installer with silent installs via Shizuku, Root or Dhizuku.
First release: Aug 9, 2026
Universal Timers io.github.hitchclimber.universaltimersFlexible interval timers for sports training with dynamic duration control
First release: Oct 8, 2026
UnjumbleApp com.wbpxre150.unjumbleappFirst release: Jun 20, 2025
- Unlauncher com.jkuester.unlauncher
First release: Jan 12, 2024
- UnlicenseLauncher unlicense.launcher
Simple and secure FOSS launcher with fully FREE🐍 license
First release: Sep 12, 2026
UnlockMaster com.sweak.unlockmasterApp promoting mindful phone use by tracking unlocks, setting limits, and stats.
First release: Dec 30, 2025
- Unmark com.unmark.app
First release: Aug 14, 2026
Unmukto com.mua.unmuktoAn offline Bengali keyboard using the Probhat layout. No permissions.
First release: Aug 10, 2026
Unofficial CheckMK Monitoring com.checkmk.unofficial_checkmk_monitoringFirst release: Sep 9, 2026
uNote app.varlorg.unoteLightweight and minimalist notepad
First release: Jul 3, 2025
- uNote app.varlorg.unote.debug
First release: Aug 3, 2026
- Unpopular Music Player de.kromke.andreas.unpopmusicplayerfree
First release: Sep 3, 2025
Unreal Speccy Portable app.uspFirst release: Mar 8, 2025
- UnscopeMyData com.kepat.unscopemydata
First release: Sep 9, 2026
Unstoppable io.horizontalsystems.bankwalletBitcoin, Ethereum, DeFi
First release: Feb 6, 2026
- Untare unofficial.tandoor.recipes
First release: Sep 15, 2024
Untracker me.zhanghai.android.untrackerRemove tracking information before sharing links
First release: Jul 4, 2025
- UntrackMe app.fedilab.nitterizeme
First release: Jul 31, 2026
Update Me com.updatemeInstall and update your favorite modded apps securely with a beautiful UI
First release: Jul 21, 2024
UP-Example org.unifiedpush.exampleExample application using UnifiedPush library
First release: Sep 30, 2025
UPI Expense Tracker com.goushik.upiwalletFirst release: Sep 24, 2026
- UPnP Explorer com.samueljhuf.upnp_explorer
First release: Aug 30, 2025
UPnP Kino acab.naiveha.upnpkinoFirst release: Oct 3, 2026
UpVPN app.upvpn.upvpnFirst release: Oct 7, 2026
- Urdu for AnySoftKeyboard com.anysoftkeyboard.languagepack.mirfatif.urdu
First release: Jul 31, 2026
Urik com.urik.keyboardPrivacy-focused Android keyboard
First release: Feb 10, 2026
- URLCheck com.trianguloy.urlchecker
First release: Dec 22, 2025
URL Cleaner com.svenjacobs.app.leonRemoves tracking & other redundant parameters from web links for sharing
First release: Sep 9, 2025
Url forwarder net.daverix.urlforwardFirst release: Jul 6, 2025
URL Radio com.jamal2367.urlradioFirst release: Sep 1, 2026
- URLSanitizer moe.dic1911.urlsanitizer
First release: Jul 3, 2025
Urn com.illiouchine.jmOffline polls to decide and vote using Majority Judgment
First release: Jul 27, 2025
URnetwork com.bringyour.networkFirst release: Sep 24, 2025
URSA dev.astoris.ursaNative Android client for Uptime Kuma with FOSS push, no Google services.
First release: Aug 21, 2026
- URV Manager app.universal.revanced.manager
First release: Oct 4, 2026
Usagi org.draken.usagiFirst release: Sep 9, 2026
USB Camera dev.yaky.usbcamviewerView a video stream from a connected USB camera.
First release: May 25, 2025
- USB Device Info aws.apps.usbDeviceEnumerator
First release: Apr 17, 2025
USBDevInfo org.kaijinlab.usbdevinfoInspect USB devices with full descriptor and HID details
First release: Oct 8, 2026
USBDongleControl io.github.tommygeenexus.usbdonglecontrolcontrol USB audio dongles
First release: Sep 19, 2025
USB HID Client me.arianb.usb_hid_clientuse your phone as a keyboard and mouse WITHOUT any software on the other end
First release: Aug 29, 2025
- USB Serial Telnet Server com.clusterrr.usbserialtelnetserver
First release: Jun 19, 2025
- UT.urn ac.stresa.uturn
A service app providing YouTube contents to Podcini.A
First release: Sep 8, 2026
UWR Planer de.uwrplan.appMatch planning for underwater rugby – the UWR Planer app.
First release: Aug 27, 2026
- V2EX im.fdx.v2ex
First release: Jul 31, 2026
- V2EX im.fdx.v2ex.debug
First release: Oct 18, 2018
v2ray com.github.shadowsocks.plugin.v2rayFirst release: Oct 8, 2026
v2rayNG com.v2ray.angFirst release: Oct 11, 2026
- v2rayNG (F-Droid) com.v2ray.ang.fdroid
First release: Jul 31, 2026
- Vaani dr.blank.vaani
First release: Jan 10, 2026
- Vacation Days rocks.poopjournal.vacationdays
First release: Feb 14, 2026
Valencia Transit Reloaded com.albertodiaz.valencia_transit_reloadedFirst release: Oct 7, 2026
- Valetudo Companion cloud.valetudo.companion
First release: Jan 7, 2026
Valv se.arctosoft.vaultAn encrypted gallery vault for Android devices
First release: Jul 15, 2025
- Vanaccess com.vanaccess.bms
First release: Jul 31, 2026
Vanilla com.sosauce.cutecalcA cute and elegant calculator app for Android
First release: Sep 7, 2025
- Vanilla Music ch.blinkenlights.android.vanilla
First release: Jan 30, 2024
Vape Tools com.geovnn.vapetoolsCoil and e-liquid tools.
First release: Sep 21, 2025
- Variometer info.altimeter.variometer
First release: Jan 5, 2026
- VAT Calculator biz.binarysolutions.vatcalculator
First release: Jul 12, 2025
- Vault com.arsvechkarev.vault
First release: Mar 3, 2024
VaultPony dev.norsehorse.vaultponyEncrypted vaults you control, compatible with VeraCrypt.
First release: Sep 19, 2026
VaultX com.chiranth7.vaultxSecure offline password and identity wallet manager
First release: Sep 23, 2026
VCMI is.xyz.vcmiFirst release: Dec 30, 2025
Vector Camera com.dozingcatsoftware.vectorcameraWireframe, text, and color effects for your camera
First release: Oct 27, 2026
- Vector Pinball com.dozingcatsoftware.bouncy
First release: Mar 18, 2022
Vectras VM Github com.vectras.vmFirst release: Dec 28, 2024
Vegan Inspector app.vegan_inspectorFirst release: Oct 7, 2026
- Veilleuse io.github.pic38.veilleuse
First release: Sep 7, 2026
Veil Wallet org.veilproject.walletFirst release: Oct 28, 2024
Velune com.nikhil.ytFirst release: Oct 8, 2026
venera com.github.wgh136.veneraA comic reader that support reading local and network comics.
First release: Jan 1, 2026
Vento net.pgaskin.remotedesktopFirst release: Sep 20, 2026
Ventoid com.ventoid.appPrepare Ventoy-style bootable USB drives from Android without root.
First release: Jul 27, 2026
Verdetto com.verdettoqr.scannerQR & barcode scanner. See the link before it opens.
First release: Sep 26, 2026
VergissNix de.andicodes.vergissnixCreate short and simple reminders.
First release: Oct 7, 2025
Verified Apps org.privacyguides.verifiedappsAn app signing certificate hash verifier based on a crowdsourced dataset.
First release: Oct 8, 2026
Vernet org.fsociety.vernetKnow your network. Discover, scan & diagnose.
First release: Nov 2, 2025
VerveDo cn.super12138.todoA concise to-do app that follows Material 3 Expressive.
First release: Feb 10, 2026
- vesIC com.vincentengelsoftware.vesandroidimagecompare
First release: Jul 5, 2025
Vespucci de.blau.androidFirst release: Sep 14, 2025
Veto com.quantum_prof.vtscansuiteOpen source, native VirusTotal client. Scan files, links and apps in style.
First release: Sep 9, 2026
Vetro com.phnem.vetroMinimal local-first media manager
First release: Aug 3, 2026
Vibe dev.fiedri.vibeFirst release: Aug 29, 2026
- Vibe me.lucky.vibe
First release: Nov 25, 2025
- Vibecheck com.aradar.vibecheck
First release: Aug 16, 2026
- Vibrator com.lukeneedham.vibrator
First release: Jan 26, 2024
Victoria Launcher dev.victorialauncherAn open source Niagara Launcher alternative — a minimal, list-based home screen
First release: Sep 9, 2026
- VideLibri de.benibela.videlibri
First release: Nov 30, 2025
Video Diary com.lukeneedham.videodiaryFirst release: Feb 16, 2025
- Video Live Wallpaper io.github.codeg0blin.videowallpaper
First release: Oct 7, 2026
- Video Screensaver systems.sieber.vscreensaver
First release: Aug 1, 2026
Vidya Music com.mateusrodcosta.apps.vidyamusicA player for the Vidya Intarweb Playlist (aka VIP Aersia)
First release: Nov 19, 2025
- ViewCarousel io.github.wandomium.viewcarousel
First release: Jan 10, 2026
- Vinyl Music Player com.poupa.vinylmusicplayer
First release: Aug 1, 2026
- Vinyl Music Player com.poupa.vinylmusicplayer.ci
First release: Jan 27, 2023
VirtualGamePadMobile io.github.kitswas.virtualgamepadmobileAndroid phone as a gamepad for your PC
First release: Dec 31, 2025
Visual Routines io.github.ewoc2026.visualroutinesCreate and follow calm visual routines one step at a time
First release: Oct 3, 2026
- Vitosha Decision Maker eu.veldsoft.vitoshadm
First release: Sep 16, 2025
VIVATLAS com.vivatlas.appYour self-hosted catalogue of AI skills, agents and MCP servers, in your pocket.
First release: Oct 16, 2026
VIVI com.vivi.vivimusicFirst release: Jan 24, 2026
VLC org.videolan.vlcThe best video and music player. Fast and “just works”, plays any file
First release: Jan 22, 2026
vlogstr com.vlogstr.appFirst release: Oct 8, 2026
VMPK for Android io.github.pedrolcl.vmpkThis is the Android port of Virtual MIDI Piano Keyboard (vmpk.sourceforge.io)
First release: Aug 29, 2025
VocaPhone com.vocahq.vocaphoneVoice dictation keyboard that transcribes on hardware you control
First release: Oct 4, 2026
Voice de.ph1b.audiobookA calm audiobook player for your own files. No account, no ads.
First release: Feb 4, 2026
Voice Keyboard com.tyraen.voicekeyboardSpeech-to-text keyboard that uses your own Whisper API key
First release: Oct 13, 2026
Voice Memos io.github.acidefluorhydrique.voicememosA voice recorder with an inline player and a trim editor, no ads, no network
First release: Oct 1, 2026
Voice Notify com.pilot51.voicenotifyFirst release: Mar 22, 2025
- Voice Notify [debug] com.pilot51.voicenotify.debug
First release: Aug 3, 2026
- VoicePlus com.github.mistermo_vibecode.voiceplus
Offline audiobook player with some quality of life features.
First release: Aug 3, 2026
Voice Recorder org.fossify.voicerecorderFirst release: Sep 1, 2025
- Voicesmith de.jurihock.voicesmith
First release: Oct 17, 2025
Void Player com.tushar.voidplayerModern, high-performance music player with dynamic UI
First release: Aug 21, 2026
VoIP.ms SMS net.kourlas.voipms_smsPopular Android messaging app for VoIP.ms, a Canadian VoIP provider
First release: Jan 31, 2025
Vokibot net.canvoki.vokibotAndroid automation tool
First release: Oct 25, 2026
Volksverpetzer de.volksverpetzer.appRead Volksverpetzer fact checks, analysis and articles on your mobile phone.
First release: Jul 29, 2026
- Volt com.volt
First release: Sep 30, 2024
Voltascano com.example.timenotificationVoltascano shows battery voltage in the system status bar
First release: Sep 10, 2025
- Volume Icon org.koitharu.volumeicon
First release: Jul 31, 2026
VolumeLockr com.klee.volumelockrVolume locker
First release: Jan 1, 2026
- Volume Notification net.hyx.app.volumenotification
First release: Jun 1, 2024
- VolumeScroll com.yeapguy.volumescroll
First release: Jul 31, 2026
- Volume Tile com.jhc.volumetile
First release: Feb 20, 2024
- VolumeX com.zygisk_enc.volumeX
First release: Jul 31, 2026
Voxscribe org.y20k.voxscribeFirst release: Jul 31, 2026
Voxtral org.lesewolf.voxtralFirst release: Oct 23, 2026
- Voyager app.vger.voyager
First release: Jan 15, 2026
Voyager com.voyagerfilesVoyager - Material Design 3 file browser with SFTP, FTP, SMB, and WebDAV support
First release: Aug 7, 2026
VpnHood! CLIENT com.vpnhood.client.android.webFirst release: Jan 28, 2026
- VPN Hotspot be.mygod.vpnhotspot_foss
First release: Sep 1, 2025
- VPN Inspector com.kasumic.vpndetector
First release: Jul 28, 2026
- VPT#002-PWG v4lpt.vpt.pwg
First release: Nov 13, 2025
- VPT#003-GDP - Gesture Drawing Practice v4lpt.vpt.f003.gdp
First release: Aug 14, 2024
- VPT#005-RSD - Roll Some Dice v4lpt.vpt.f005.rsd
First release: Aug 14, 2024
- VPT#006-YXN - Yes XOR No? v4lpt.vpt.f006.yxn
First release: Aug 8, 2024
- VPT#012-RYP - Rate Your Pics v4lpt.vpt.f012.ryp
First release: Oct 14, 2024
- VPT#016-TPC - Tomato Potato Clock v4lpt.vpt.c016.TPC
First release: Jul 8, 2025
- VPT#018-VPC - Volume Percent Calculator v4lpt.vpt.i018.vpc
First release: Aug 8, 2024
- VPT#023-MYC - Memorize Your Classics v4lpt.vpt.f023.MYC
First release: Jan 16, 2025
- VPT#036-ETW - Ease The Waiting v4lpt.vpt.f036.esw
First release: Sep 23, 2024
VRChat Android Assistant cc.sovellus.vrcaaFirst release: Feb 11, 2026
- VRChat Android Assistant cc.sovellus.vrcaa.pico
First release: Mar 2, 2026
- VRChat Android Assistant cc.sovellus.vrcaa.quest
First release: Sep 27, 2026
VScan com.rastislavkish.vscanA visual perception layer for the blind
First release: Sep 13, 2025
WA Adder com.aj.wa.contact.adderFirst release: Mar 14, 2025
- WADBS com.smoothie.wirelessDebuggingSwitch
First release: Sep 19, 2024
- WaDoku de.miraisoft.wadoku
First release: May 14, 2025
Wafrn dev.djara.wafrn_rnThe social network that respects you
First release: Jan 27, 2026
- WageBit com.wagebit.app
First release: Jul 31, 2026
- Waistline com.waist.line
First release: Jun 3, 2025
Wake Me io.github.anka1981.weckmichAlarm clock for alternating weeks, timetables and rules like every 1st Tuesday
First release: Oct 12, 2026
Wake on Lan de.florianisme.wakeonlanFirst release: Aug 3, 2026
WakeUpScreen com.symeonchen.wakeupscreenFirst release: Aug 11, 2026
- WalkersGuide org.walkersguide.android
First release: Feb 10, 2026
- wallabag fr.gaulupeau.apps.InThePoche
First release: May 24, 2024
- WallApp com.debojit.wallapp
First release: Jul 31, 2026
- WallApp com.debojit.wallapp.debug
First release: Aug 3, 2026
- Wallet com.sidhant.wallet
First release: Jan 29, 2026
- WallFlow (Alpha) com.ammar.wallflow
First release: Apr 13, 2024
Wallosmobile com.grappim.wallosmobileFirst release: Nov 1, 2026
- WallpaperExport com.github.cvzi.wallpaperexport
First release: Jul 6, 2025
Wall You com.bnyro.wallpaperPrivacy focused wallpaper app built with MD3
First release: Sep 30, 2025
warecache com.slanttech.warecacheFirst release: Oct 8, 2026
Warpinator slowscript.warpinatorShare files across local network
First release: Dec 27, 2025
Warsmash net.warsmash.phoneFirst release: Mar 3, 2025
- Was geht? de.cyberit.wasgeht
First release: Aug 7, 2025
Wassword com.albertobonacina.wasswordCreate unbreakable passwords in one tap
First release: Jul 15, 2025
Waterfly III com.dreautall.waterflyiiiUnofficial App for Firefly III, an open source personal finance manager.
First release: Jan 10, 2026
- Water Quality com.yinmik.waterquality
First release: Jul 31, 2026
Water Sort com.sidhant.watersortRelaxing color-sorting puzzle. Infinite levels. Zero tracking. No ads.
First release: Aug 3, 2026
- Watomatic com.parishod.watomatic
First release: Sep 25, 2024
- Wattz dubrowgn.wattz
First release: Aug 6, 2025
- Wave Lines Wallpaper de.markusfisch.android.wavelines
First release: Dec 16, 2025
WaveUp com.jarsilio.android.waveupFirst release: Apr 12, 2025
WaveUp Tasker com.jarsilio.android.waveup.taskerUse this simple Tasker plugin to enable/disable WaveUp at will.
First release: Apr 9, 2025
Wavlake com.wavlake.mobileFirst release: Jul 3, 2025
WD Cable com.jingcjie.wifi_direct_cableOffline file, chat, speed test, and audio transfer over Wi-Fi Direct.
First release: Oct 8, 2026
- Wear Sync for Breezy com.steel101.wearsyncforbreezy
First release: Aug 3, 2026
Weather com.vayunmathur.weatherA modern, open-source weather app with Material You
First release: Oct 12, 2026
- Weather in.sunilpaulmathew.weatherwidget
First release: Jul 10, 2025
- Weather. Cool and Hot org.asafonov.weather
First release: Jan 21, 2026
- Weather Doge com.versobit.weatherdoge.foss
First release: Apr 1, 2025
- Weather Forecast uk.org.boddie.android.weatherforecast
First release: Jan 30, 2025
- Weather Forecast USA biz.binarysolutions.weatherusa
First release: Aug 24, 2025
WeatherGrid nl.baasmail.weathergridA clean, modern 3-hour forecast grid widget for your home screen.
First release: Oct 14, 2026
WeatherMaster com.pranshulgg.weather_master_appFirst release: Jan 22, 2026
- Weathernaut me.tangobee.weathernaut
First release: Sep 22, 2024
- Weather Radar com.danhasting.radar
First release: Jul 31, 2026
Weather Shortcut de.kaiserdragon.weathershortcutShortcut to open the weather view of the Google App
First release: Dec 2, 2024
WebCapture com.tawhid.webcaptureFirst release: Feb 2, 2025
- WebCast com.github.warren_bank.webcast
First release: Nov 26, 2024
- WebInspector com.agatamessina.webinspector
First release: Aug 2, 2026
WebLibre eu.weblibre.geckoPrivacy-focused browser with local AI, advanced tab management, personal search,
First release: Feb 7, 2026
- WebMonkey com.github.warren_bank.webmonkey
First release: Feb 4, 2026
- Website Monitor com.manimarank.websitemonitor
First release: Sep 25, 2025
Websocket CAM app.umerfarooq.websocketcamAccess Android camera via Websocket client API
First release: Oct 7, 2026
Webspace org.codeberg.theoden8.webspaceBring your favorite web apps to your phone
First release: Aug 8, 2026
WebStack com.chiranth7.webstackVisual bookmark manager for Android with offline snapshot saving.
First release: Sep 23, 2026
Webview Kiosk uk.nktnet.webviewkioskTurn your Android device into a locked-down web page in fullscreen mode.
First release: Feb 25, 2026
- Weechat-Android com.ubergeek42.WeechatAndroid
First release: Jul 31, 2026
- Weechat-Android com.ubergeek42.WeechatAndroid.dev
First release: Mar 2, 2025
Weight Logger org.kochka.android.weightloggerFirst release: Feb 19, 2025
Welefon de.wivewa.dialerFirst release: Sep 9, 2025
- Weread cyou.sk5s.app.weread
First release: Jan 21, 2026
werewolves_game io.github.davidchilin.werewolves_gameMultiplayer server for Mafia party game Werewolves. Plays in webbrowser on WiFi.
First release: Sep 9, 2026
Werkzeug xyz.waozi.passPrivate tools: deterministic passwords, 2FA codes, calculator and clock.
First release: Oct 13, 2026
WG Auto Connect de.marionoll.wgautoconnectAuto connect to a WireGuard tunnel
First release: Mar 8, 2024
WGControl org.supersane.wgcontrolAutomated WireGuard tunnel control via home Wi-Fi and Bluetooth.
First release: Oct 18, 2026
wger de.wger.flutterFirst release: Sep 23, 2025
WG Tunnel com.zaneschepke.wireguardautotunnelFirst release: Aug 14, 2025
- WG Tunnel Nightly com.zaneschepke.wireguardautotunnel.nightly
First release: Jan 25, 2026
what I watch io.codeberg.allibragi.whatiwatchTrack the series you're currently watching
First release: Aug 21, 2026
- WhatsApp com.whatsapp
First release: Feb 13, 2026
WhatsAppCleaner com.vishnu.whatsappcleanerCleaner for WhatsApp - Clean Redundant Media and Files from Storage
First release: Aug 24, 2025
- WhatsApp Web To Go io.kuenzler.whatsappwebtogo
First release: Oct 4, 2022
- Whatsap Status com.vinithreddybanda.whatsapstatus
First release: Jan 3, 2026
- WhatSave com.simplified.wsstatussaver
First release: May 8, 2025
WhatsDown com.seyfal.whatsdown⚡ Fast encrypted chats for the family 🎉
First release: May 5, 2025
- WhatsOpen com.harshalbhatia.whatsopen
First release: Jul 31, 2026
Where net.af0.whereFirst release: Oct 3, 2026
Where It Went com.pixelpen.whereitwent.stableYou think you know. Then you see the numbers. Track where it really went.
First release: Oct 15, 2026
Whip io.github.kaminarios.whipFirst release: Jul 28, 2026
Whisper com.nyancatlabs.whisperCalm, private news from the sites you choose. No account, works offline.
First release: Oct 12, 2026
- Whisper org.woheller69.whisper
First release: Feb 1, 2026
- Whisper+ org.woheller69.whisperplus
First release: Feb 1, 2026
Whisper Noise io.gitlab.the_phoenix_project0.whisper_noiseFirst release: Sep 4, 2026
WhisperType me.trion.whispertypeOffline Android keyboard with QWERTY typing and on-device speech dictation
First release: Aug 10, 2026
Whitehole com.bera.whiteholeA feature-packed photo manager on top of Telegram.
First release: Nov 8, 2024
White Noise dev.ipf.whitenoise.androidFirst release: Oct 14, 2026
whoBIRD org.woheller69.whobirdRecognize birds by their sounds, anywhere in the world!
First release: Dec 8, 2025
Who Goes First? dev.j7126.who_goes_firstFirst release: Jul 6, 2025
- Who Has My Stuff? de.freewarepoint.whohasmystuff
First release: Oct 2, 2025
WHPH me.ahmetcetinkaya.whphUnified productivity: tasks, habits, time & app tracking, notes, analytics.
First release: Feb 11, 2026
Why? cz.kutner.whyAsks why you unlock your phone. See your habits. No internet. No tracking.
First release: Oct 13, 2026
- Widget for Trello™ com.oryanmat.trellowidget
First release: Dec 3, 2024
Widgets Anywhere tk.zwander.lockscreenwidgetsFirst release: Feb 5, 2026
- Widgets Anywhere Wallpaper Plugin dev.zwander.lswwallpaper
First release: Jul 21, 2026
- WiFiAnalyzer com.vrem.wifianalyzer
First release: Jan 10, 2026
WiFi Audio Streaming com.cuscus.wifiaudiostreamingStream audio over your local network
First release: Sep 2, 2025
- WiFi Exporter dev.mlm.wifi_exporter
First release: Jan 7, 2026
Wi-Fi Info com.truemlgpro.wifiinfoShows all possible information about Wi-Fi network you are connected to.
First release: Nov 1, 2025
WiFi Password Manager io.github.wifi_password_managerSimple app using Shizuku or root access to manage WiFi passwords
First release: Feb 2, 2026
WiFi Seeker ru.raslav.wirelessscanFirst release: Oct 10, 2025
- WiFi Walkie Talkie org.jsl.wfwt
First release: Mar 13, 2025
WiFi Widget com.w2sv.wifiwidgetConfigurable widget for the monitoring of your WiFi connection details
First release: Sep 29, 2025
WiGLE WiFi Wardriving FOSS net.wigle.wigleandroidFirst release: Aug 26, 2026
Wiki Fronted com.hicorenational.wikipediaWikipedia app with censorship circumvention
First release: Feb 6, 2026
- Wikipedia org.wikipedia
The official app for Wikipedia, the world’s largest source of information.
First release: Oct 18, 2026
Wikipedia Alpha org.wikipedia.alphaFirst release: Feb 12, 2026
WikiReader org.nsh07.wikireaderRead Wikipedia pages distraction-free
First release: Oct 9, 2025
- Wikisource Reader org.cis_india.wsreader
First release: Sep 1, 2026
WikWok com.github.terrakok.wikwok.androidAppFirst release: Jun 1, 2025
Wind Bubble io.github.mickaelmagniez.windbubbleSee where the wind hits you, on top of your navigation app.
First release: Sep 16, 2026
Windscribe com.windscribe.vpnFast VPN for privacy, encrypted connections, and unlimited access.
First release: Aug 28, 2024
Windy Live Wallpaper net.pgaskin.windyFirst release: Aug 12, 2026
Winlator com.winlatorFirst release: Jul 8, 2025
Winterkongress 2026 Schedule ch.digitale_gesellschaft.winterkongress.scheduleFirst release: Oct 8, 2026
Wire com.wireWire offers highly secure communication – anywhere and anytime.
First release: Feb 11, 2026
Wishday net.stuckless.wishdayBirthday reminders that text people for you, by SMS, Signal or WhatsApp
First release: Oct 15, 2026
Wispar app.wispar.wisparFirst release: Oct 17, 2025
WiVeWa de.wivewa.androidFirst release: Mar 5, 2025
WizeStream org.wisso.newpipematerialFirst release: Jul 30, 2026
- W Launcher com.achunt.weboslauncher
First release: Jun 13, 2025
WLED ca.cgagnier.wlednativeandroidFind, manage and control all your WLED devices from your android device
First release: Jan 7, 2026
WLVD org.worldlabourvalues.wlv_panelWLVD - World Labour Values Database panel
First release: Oct 14, 2026
WM Keyboard com.wasimaster.wmkeyboardA private, offline keyboard: 955 languages, smart typing, themes, and tools.
First release: Sep 14, 2026
Wolf Gallery dev.encgalleryFirst release: Jul 31, 2026
WolLight com.iwadjp.wollightWake-on-LAN app with device list, LAN scan and stale-IP recovery. LAN-only.
First release: Oct 15, 2026
- WordleSolver org.billthefarmer.solver
First release: Feb 1, 2026
Word Maker com.vayunmathur.games.wordmakerFirst release: Jan 4, 2026
- Word of the Day com.saverio.wordoftheday_en
First release: Oct 14, 2024
words.hk hk.words.wordshkFirst release: Mar 1, 2025
- Word Tracer com.wordtracer.app
First release: Jul 31, 2026
- Working Time Account askanimus.arbeitszeiterfassung2
First release: Aug 11, 2025
- Workouts'N'Rest com.fitworkoutfast
First release: Aug 3, 2026
- WorkTimer com.mcsnowflake.worktimer
First release: Dec 11, 2025
World Clock v2 de.ericz.worldclockv2First release: Oct 18, 2025
- WorldMap com.sigseg.android.worldmap
First release: Oct 1, 2024
wormhole eu.heili.wormholeFirst release: Nov 6, 2025
Wormhole William io.sanford.wormhole_williamFirst release: Nov 30, 2024
- Wortmühle de.huepping.wortmuehle
First release: Aug 23, 2026
- WP/VPN Switch io.github.snood21.workprofilevpnswitcher
Automatically manage work profile when VPN connects or disconnects
First release: Aug 16, 2026
- wrbattlesim com.wrbattlesim
First release: Jul 31, 2026
Wristotle Companion com.lazydevs.wristotleVoice control for Pebble watches — on-device by default, no account.
First release: Jul 26, 2026
WriteOn com.ezpnix.writeonFirst release: Sep 5, 2025
wuxialearn com.wuxialearn.wuxialearnApp to learn Chinese
First release: Mar 25, 2025
- wX joshuatee.wx
First release: Oct 7, 2025
- Wyoming Android TTS home.wyoming_android_tts.indigane
First release: Jun 30, 2025
- x2vx sh.unlimi.x2vx
First release: Jun 15, 2024
XCSoar org.xcsoarTactical glide computer and maps
First release: Aug 13, 2024
- XCSoar org.xcsoar.foss
First release: Mar 22, 2026
- XDYou io.github.benderblog.traintime_pda
First release: Dec 20, 2025
Xed-Editor com.rk.xededitorFirst release: Jan 1, 2026
Xeonjia xyz.deepdaikon.xeonjiaSave the world by solving ice puzzles and defeating enemies!
First release: Nov 5, 2024
XiVPN io.github.exclude0122.xivpnProxy client based on XRAY
First release: Jan 26, 2026
XLOG2 ro.scripca.xlog2Peer-to-peer amateur-radio field logbook that syncs with the xlog2 desktop
First release: Aug 4, 2026
- XLogcatManager dev.agnosticapollo.xlogcatmanager
First release: Jan 28, 2024
- xManager com.xc3fff0e.xmanager
First release: Aug 15, 2025
- XMLForge in.hridayan.xmlforge
First release: Apr 18, 2025
XMRPod com.xmrchat.xmrpodPodcast player with Monero tipping support.
First release: Aug 10, 2026
xnotes com.xnotesHandwriting notes and sketching app with stylus support
First release: Aug 2, 2026
- Xournal++ viewer de.thefeiter.xournalviewer
First release: May 9, 2024
XPENC com.yash.xpencOffline expense tracker — accounts, budgets, dues and insights, all on-device
First release: Aug 5, 2026
- XposedSmsCode com.github.tianma8023.xposed.smscode
First release: Jan 5, 2024
- Xray io.github.saeeddev94.xray
First release: Feb 19, 2026
XrayFA com.android.xrayfaXrayFA is a fast, secure, and user-friendly Android client for Xray-core.
First release: Sep 15, 2026
xray-plugin com.github.shadowsocks.plugin.xrayFirst release: Aug 30, 2024
XRCB com.xrcbappFirst release: Jun 24, 2024
xrooster com.phoebesoftware.xroosterFirst release: Feb 5, 2026
- XryptoMail org.atalk.xryptomail
First release: Jul 29, 2025
XScreenSaver org.jwz.xscreensaverFirst release: Feb 23, 2025
X Server au.com.darkside.xdemoFirst release: Mar 31, 2025
- XtMapper xtr.keymapper
First release: Aug 20, 2025
Xtra com.github.andreyasadchy.xtraThird-party Twitch client
First release: Feb 5, 2026
YAACC de.yaaccUPNP/DLNA client and server
First release: Oct 14, 2025
YacGuide com.yacgroup.yacguideYet Another Climbing Guide
First release: Jan 6, 2026
YacGuide Dev com.yacgroup.yacguide.devYet Another Climbing Guide - Development Version
First release: Oct 27, 2026
yadaw org.mlm.yadawA multiplatform sfx creator with no plugin GUI
First release: Aug 18, 2026
- Yaga com.github.vauvenal5.yaga
First release: Jul 9, 2024
YA Habit Tracker com.zavedahmad.yaHabitYA Habit Tracker is a Modern Habit Tracker
First release: Sep 7, 2025
Yahora com.podxboq.yahoraOne tap records that something happened. There is nothing else to fill in
First release: Sep 7, 2026
- YAM com.degeder.yam
First release: Nov 1, 2025
- YAM Launcher eu.ottop.yamlauncher
First release: Jan 25, 2026
YAPL be.moraine.yaplPrivate, offline flight logbook with EASA/BCAA paper-logbook PDF export.
First release: Oct 7, 2026
- Yatoo com.paultirk.yatoo
First release: Oct 9, 2024
- Yeeemp art.pegasko.yeeemp
First release: Jun 7, 2025
- yetCalc yetzio.yetcalc
First release: Jan 24, 2025
Yggdrasil eu.neilalexander.yggdrasilOfficial implementation for connecting to the Yggdrasil Network from Android
First release: Jan 8, 2025
Yivi org.irmacard.cardemuYour digital identity in one app.
First release: Feb 1, 2026
ylih it.eldavo.ylihTrack how many hours each pair of headphones lasts. Offline, forever, private
First release: Aug 14, 2026
Youamp ru.stersh.youampMusic player for Subsonic servers with modern Material You interface
First release: Sep 21, 2025
You Have Mail dev.lbeernaert.youhavemailEmail Notification without Google Play Services
First release: Feb 10, 2026
YouPipe com.vayunmathur.youpipeA Material 3 based alternative to NewPipe using the same extractor
First release: Oct 12, 2026
- Your local weather org.thosp.yourlocalweather
First release: Jan 1, 2026
- Your very own Sun! com.ghisguth.sun
First release: Jul 31, 2026
YouTube Conv.axs com.pg_axis.ytcnvFirst release: Jul 29, 2026
- You Tune app.suhasdissa.karaoke
First release: Apr 4, 2024
- YtAlarm net.turtton.ytalarm
First release: Jan 10, 2026
YTDLnis com.deniscerri.ytdlAndroid Video/Audio Downloader app using yt-dlp
First release: Jul 28, 2025
- yt-dlp-kivy fr.odrevet.youtube_dl_kivy
First release: Sep 1, 2025
YtReader com.deedeedev.ytreaderRead YouTube subtitles with AI-powered text cleaning
First release: Oct 31, 2026
Yubico Authenticator com.yubico.yubioathGenerate OATH codes with YubiKey NEO over NFC
First release: Jun 11, 2025
Yumi Co. Radio net.yumicoradio.androidA 24/7 radio station playing Future Funk, City Pop and more, with live chat.
First release: Aug 16, 2026
Zabb com.vitexsoftware.zabbFirst release: Sep 22, 2026
- Zade's Wallpaper net.viggers.zade.wallpaper
First release: Apr 15, 2024
- Zaelio com.zaelio.app
Offline tracker for custom sessions and measurements
First release: Sep 15, 2026
Zahlenschatzjagd io.github.glaside.zahlenschatzjagdMaths practice for school years 1 and 2 – offline, ad-free, in German
First release: Oct 11, 2026
Zanshin io.github.iverlein.zanshinTibetan and Japanese calendars with almanac readings, and a meditation timer
First release: Oct 2, 2026
Zapp de.christinecoenen.code.zappCollection of German public broadcasting live streams
First release: Feb 4, 2026
- zapstore zapstore
First release: Sep 23, 2025
Zazen com.zazenA minimal, offline meditation timer with interval bells.
First release: Oct 2, 2026
- Zazen Meditation Timer at.priv.graf.zazentimer
First release: Jul 31, 2026
- Zelp dev.otaj.zelp
First release: Sep 9, 2026
Zenith com.etrisad.zenithFirst release: Oct 16, 2026
Zenwell com.sarangem.zenwellBlock distracting apps and reduce screen time
First release: Sep 12, 2026
Zerion com.professor.zerionEncrypted chats, calls and channels over Tor. No phone number, no email.
First release: Aug 11, 2026
Zest com.yoshi.todarkTask management application.
First release: Dec 23, 2025
Zham io.github.haykh.zhamOffline world clock with a home-screen widget and time-zone converter.
First release: Oct 8, 2026
Zimly app.zimly.backupFirst release: Feb 6, 2026
zinna-IME io.github.soichi11208.zinnaOffline Japanese keyboard with mozc conversion, flick and qwerty
First release: Oct 25, 2026
Zipline com.stefdp.ziplineFirst release: Aug 1, 2026
ZipXtract com.wirelessalien.zipxtractExtract and create various archive formats like ZIP, RAR, 7z, and more
First release: Jan 16, 2026
zmNinja com.zoneminder.zmNinjaFirst release: Sep 9, 2025
Zodl co.electriccoin.zcash.fossThe most private crypto wallet. Built for financial sovereignty.
First release: Jan 28, 2026
- Zola zola
Your one-stop static site engine
First release: Jul 14, 2025
Zood Location xyz.zood.georgeFirst release: Jun 1, 2025
Zorin Connect com.zorinos.zorin_connectConnect your Zorin OS computer with your device
First release: Sep 9, 2025
Zoysii xyz.deepdaikon.zoysiiA simple logic game: find the best path to delete every number in a square space
First release: Aug 26, 2024
zSMTH com.zfdang.zsmth_androidClient for SMTH BBS
First release: Oct 14, 2026
- zsp zsp
First release: Feb 13, 2026
Zulip com.zulipmobileOpen-source team chat that helps teams stay productive and focused
First release: Jan 27, 2026
ZXTune app.zxtuneFirst release: Sep 23, 2026
ZXTune app.zxtune.fdroidFirst release: Jul 1, 2025
الأذكار النووية com.hassaneltantawy.alazkarImam Al-Hafiz Yahya bin Sharafah Al-Din Al-Nawawi.
First release: Jun 9, 2025
- حصن المسلم com.hassaneltantawy.hisnelmoslem
First release: Oct 13, 2025
قرآني com.dmouayad.my_quranFirst release: Feb 9, 2026
- قضاء com.hassaneltantawy.qadaa
First release: Oct 16, 2025
نور الهدى com.mirfatif.noorulhudaA simple, open source Quran reader app with extras, completely free forever
First release: Aug 29, 2026
α-Remote org.staacks.alpharemoteFirst release: Aug 29, 2025
εκκλησία ekklesia.grAnonymous civic participation for Greek citizens
First release: Aug 17, 2026
- μLauncher de.jrpie.android.launcher
First release: Jan 18, 2026
- μLauncher [debug] de.jrpie.android.launcher.debug
First release: Feb 8, 2026
- μlogger net.fabiszewski.ulogger
First release: Sep 25, 2025
μ's io.github.kkoshin.museConvert text to natural-speaking audio with custom voices and pauses
First release: Jan 18, 2026
Морской бой net.tigr.navyfleetbattleFirst release: Jul 31, 2026
- Трансліт ua.bossly.tools.translit
First release: Sep 5, 2025
Шляпа ru.lksh.beretFirst release: Mar 25, 2024
中文轉換 com.iatfei.tsconverterConverts between Simplified and Traditional with regional variants support!
First release: Mar 5, 2025
- 企鹅通知进化 cc.chenhe.qqnotifyevo
First release: Mar 31, 2024
天使动漫 kzs.th000.tsdm_clientFirst release: Nov 24, 2025
- 媒体音量磁贴 cn.morfans.chenjunyu19.mediavolume
First release: Sep 3, 2025
- 开屏跳过 com.zfdang.touchhelper
Skip opening-screen ads in apps
First release: Sep 23, 2026
- 拷贝Lite top.fumiama.copymangaweb
First release: Jul 6, 2025
掼蛋 page.codeberg.lanticy.guandanGuandan card game for four players over local Wi-Fi. No server, no account.
First release: Aug 10, 2026
曦码输入法 com.kingzcheung.ximeA Rime-based Chinese IME for Wubi and Pinyin input
First release: Sep 3, 2026
校园助手 io.github.danxi_dev.dan_xiFirst release: Sep 8, 2025
照度测量仪 com.example.lightmeterFirst release: Jan 16, 2026
- 素扉 dev.wceng.sufei
First release: Jul 31, 2026
聊天室 com.chatroom.appReal-time messaging client with text and file sharing.
First release: Aug 16, 2026
- 萊姆輸入法 info.plateaukao.sweetlime
First release: Jul 31, 2026
- 萊姆輸入法 net.toload.main.hd
First release: Aug 1, 2026
记忆 com.github.xiaoshihou.jiyiEncrypted audio logging app
First release: Jan 31, 2026
通知日历同步 top.stevezmt.calsyncFirst release: Dec 29, 2025
- 随机姓名 com.hello.randomname
First release: Aug 28, 2026
Sats Received
Underlying data available via MCP: app_zaps, app_releases, app_catalog.
Zap Count
Underlying data available via MCP: app_zaps, app_releases, app_catalog.